Details of Protein
General Information of Protein (ID: PRT00823) | |||||
---|---|---|---|---|---|
Name | Coenzyme Q protein 8A (COQ8A) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
Chaperone activity of bc1 complex-like; Chaperone-ABC1-like; Atypical kinase COQ8A, mitochondrial; aarF domain-containing protein kinase 3; Coq8a; Adck3; Cabc1
|
||||
Gene Name | Coq8a | Gene ID | |||
UniProt ID | |||||
Family | Transferases (EC 2) | ||||
EC Number | EC: 2.7.-.- (Click to Show/Hide the Complete EC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MAAMLGDAIMVAKGLAKLTQAAVETHLQNLGLGGELILAARALQSTAVEQISMVFGKVQG
QDKHEDSYATENFEDLEAEVQFSTPQAAGSSPDFSTASSLDQPLSSSLGHAHREGPAPAY VSSGPFREAGLSGQATSPLGRVNGRLFVDCRDLFLANSIQRRFFHQDQAPVGGLTAEDIE KARQAKARPESKPHKQMLSERARERKVPVTRIGRLANFGGLAVGLGFGALAEVAKKSLRS ENSTGKKAVLDSSPFLSEANAERIVSTLCKVRGAALKLGQMLSIQDDAFINPHLAKIFER VRQSADFMPLKQMTKTLNNDLGPHWRDKLEYFEERPFAAASIGQVHLARLKGGREVAMKI QYPGVAQSINSDVNNLMAVLNMSNMLPEGLFPEHLIDVLRRELTLECDYQREAAYAKKFR ELLKDHPFFYVPEIVDELCSPHVLTTELITGFPLDQAEGLSQEVRNEICYNILVLCLREL FEFHVMQTDPNWSNFFYDPQQHKVALLDFGATREYDRSFTDLYIQVIRAAADQDREAVLK KSIEMKFLTGYEVKAMEDAHLDAILILGEAFASEEPFDFGTQSTTEKIHNLIPIMLKHRL IPPPEETYSLHRKMGGSFLICSKLKACFPCKAMFEEAYSNYCRMKSGLQ |
||||
Function | Atypical kinase involved in the biosynthesis of coenzyme Q, also named ubiquinone, an essential lipid-soluble electron transporter for aerobic cellular respiration. Its substrate specificity is unclear: does not show any protein kinase activity. Probably acts as a small molecule kinase, possibly a lipid kinase that phosphorylates a prenyl lipid in the ubiquinone biosynthesis pathway, as suggested by its ability to bind coenzyme Q lipid intermediates. Shows an unusual selectivity for binding ADP over ATP. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Citrulline | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Citrulline addition (1336 hours) | |||||
Induced Change | COQ8A protein expression levels: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Healthy individual | |||||
Details | It is reported that citrulline addition causes the increase of COQ8A protein expression compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Citrulline Supplementation Induces Changes in Body Composition and Limits Age-Related Metabolic Changes in Healthy Male Rats. J Nutr. 2015 Jul;145(7):1429-37. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.