Details of Protein

General Information of Protein (ID: PRT00822)
Name Homolog of Fringe connection protein 1 (HFRC1)
Synonyms   Click to Show/Hide Synonyms of This Protein
UDP-N-acetylglucosamine/UDP-glucose/GDP-mannose transporter; SQV7-like protein; SQV7L; Solute carrier family 35 member D2; UDP-galactose transporter-related protein 8; UGTrel8; SLC35D2; HFRC; UGTREL8
Gene Name SLC35D2 Gene ID
11046
UniProt ID
Q76EJ3
Family Drug/metabolite transporter (DMT)
TC Number   TC: 2.A.7.15.1  (Click to Show/Hide the Complete TC Tree)
The Drug/Metabolite Transporter (DMT) Superfamily
The UDP-glucuronate/UDP-N-acetylgalactosamine Transporter (UGnT) Family
TC: 2.A.7.15.1
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MTAGGQAEAEGAGGEPGAARLPSRVARLLSALFYGTCSFLIVLVNKALLTTYGFPSPIFL
GIGQMAATIMILYVSKLNKIIHFPDFDKKIPVKLFPLPLLYVGNHISGLSSTSKLSLPMF
TVLRKFTIPLTLLLETIILGKQYSLNIILSVFAIILGAFIAAGSDLAFNLEGYIFVFLND
IFTAANGVYTKQKMDPKELGKYGVLFYNACFMIIPTLIISVSTGDLQQATEFNQWKNVVF
ILQFLLSCFLGFLLMYSTVLCSYYNSALTTAVVGAIKNVSVAYIGILIGGDYIFSLLNFV
GLNICMAGGLRYSFLTLSSQLKPKPVGEENICLDLKS
Function Antiporter transporting nucleotide sugars such as UDP-N-acetylglucosamine (UDP-GlcNAc), UDP-glucose (UDP-Glc) and GDP-mannose (GDP-Man) pooled in the cytosol into the lumen of the Golgi in exchange for the corresponding nucleosides monophosphates (UMP for UDP-sugars and GMP for GDP-sugars). May take part in heparan sulfate synthesis by supplying UDP-Glc-NAc, the donor substrate, and thus be involved in growth factor signaling.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Nucleosides, nucleotides, and analogues
            Guanosine diphosphate mannose Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of SLC35D2
                      Induced Change Guanosine diphosphate mannose concentration: increase (FC = 1.9)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of SLC35D2 leads to the increase of guanosine diphosphate mannose levels compared with control group.
            UDP glucose Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of SLC35D2
                      Induced Change UDP glucose concentration: increase (FC = 4.2)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of SLC35D2 leads to the increase of UDP glucose levels compared with control group.
References
1 Molecular cloning and characterization of a human multisubstrate specific nucleotide-sugar transporter homologous to Drosophila fringe connection. J Biol Chem. 2004 Jun 18;279(25):26469-74.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.