Details of Protein
| General Information of Protein (ID: PRT00796) | |||||
|---|---|---|---|---|---|
| Name | Flavin-containing monooxygenase 5 (FMO5) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
FMO 5; Baeyer-Villiger monooxygenase 1; hBVMO1; Dimethylaniline monooxygenase [N-oxide-forming] 5; Dimethylaniline oxidase 5; NAPDH oxidase; FMO5
|
||||
| Gene Name | FMO5 | Gene ID | |||
| UniProt ID | |||||
| Family | Transcription factor (TF) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MTKKRIAVIGGGVSGLSSIKCCVEEGLEPVCFERTDDIGGLWRFQENPEEGRASIYKSVI
INTSKEMMCFSDYPIPDHYPNFMHNAQVLEYFRMYAKEFDLLKYIRFKTTVCSVKKQPDF ATSGQWEVVTESEGKKEMNVFDGVMVCTGHHTNAHLPLESFPGIEKFKGQYFHSRDYKNP EGFTGKRVIIIGIGNSGGDLAVEISQTAKQVFLSTRRGAWILNRVGDYGYPADVLFSSRL THFIWKICGQSLANKYLEKKINQRFDHEMFGLKPKHRALSQHPTLNDDLPNRIISGLVKV KGNVKEFTETAAIFEDGSREDDIDAVIFATGYSFDFPFLEDSVKVVKNKISLYKKVFPPN LERPTLAIIGLIQPLGAIMPISELQGRWATQVFKGLKTLPSQSEMMAEISKAQEEIDKRY VESQRHTIQGDYIDTMEELADLVGVRPNLLSLAFTDPKLALHLLLGPCTPIHYRVQGPGK WDGARKAILTTDDRIRKPLMTRVVERSSSMTSTMTIGKFMLALAFFAIIIAYF |
||||
| Function | Acts as Baeyer-Villiger monooxygenase on a broad range of substrates. Catalyzes the insertion of an oxygen atom into a carbon-carbon bond adjacent to a carbonyl, which converts ketones to esters. Active on diverse carbonyl compounds, whereas soft nucleophiles are mostly non- or poorly reactive. In contrast with other forms of FMO it is non- or poorly active on 'classical' substrates such as drugs, pesticides, and dietary components containing soft nucleophilic heteroatoms (Probable). Able to oxidize drug molecules bearing a carbonyl group on an aliphatic chain, such as nabumetone and pentoxifylline. Also, in the absence of substrates, shows slow but yet significant NADPH oxidase activity. Acts as a positive modulator of cholesterol biosynthesis as well as glucose homeostasis, promoting metabolic aging via pleiotropic effects. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| Glutamine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
 click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Glutamine absence (16 hours) | |||||
| Induced Change | FMO5 protein abundance levels: increase (FC = 2.17) | |||||
| Summary | Introduced Variation
Induced Change
|
|||||
| Disease Status | Hepatocellular carcinoma [ICD-11: 2C12] | |||||
| Details | It is reported that glutamine absence causes the increase of FMO5 protein abundance compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Quantitative proteomics analysis reveals glutamine deprivation activates fatty acid -oxidation pathway in HepG2 cells. Amino Acids. 2016 May;48(5):1297-307. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.