Details of Protein
| General Information of Protein (ID: PRT00793) | |||||
|---|---|---|---|---|---|
| Name | E-selectin (SELE) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
CD62 antigen-like family member E; Endothelial leukocyte adhesion molecule 1; ELAM-1; Leukocyte-endothelial cell adhesion molecule 2; LECAM2; CD antigen CD62E; SELE; ELAM1
|
||||
| Gene Name | SELE | Gene ID | |||
| UniProt ID | |||||
| Family | Selectin (SeT) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MIASQFLSALTLVLLIKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLN
SILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREK DVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNC TALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVV ECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCK AVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIP VCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDN EKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQ WTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHW SGLLPTCEAPTESNIPLVAGLSAAGLSLLTLAPFLLWLRKCLRKAKKFVPASSCQSLESD GSYQKPSYIL |
||||
| Structure | |||||
| Function | Cell-surface glycoprotein having a role in immunoadhesion. Mediates in the adhesion of blood neutrophils in cytokine-activated endothelium through interaction with SELPLG/PSGL1. May have a role in capillary morphogenesis. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| Gamma-Glutamylvaline | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
 click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Gamma-Glutamylvaline addition (2 hours) | |||||
| Induced Change | SELE protein expression levels: decrease | |||||
| Summary | Introduced Variation
Induced Change
|
|||||
| Disease Status | Peritonitis [ICD-11: DC50] | |||||
| Details | It is reported that gamma-glutamylvaline addition causes the decrease of SELE protein expression compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Dietary -Glutamyl Valine Ameliorates TNF--Induced Vascular Inflammation via Endothelial Calcium-Sensing Receptors. J Agric Food Chem. 2020 Aug 26;68(34):9139-9149. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.