Details of Protein
| General Information of Protein (ID: PRT00782) | |||||
|---|---|---|---|---|---|
| Name | Discoidin domain-containing receptor 2 (DDR2) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
Discoidin domain receptor 2; CD167 antigen-like family member B; Neurotrophic tyrosine kinase, receptor-related 3; Receptor protein-tyrosine kinase TKT; Tyrosine-protein kinase TYRO10; CD antigen CD167b; Ddr2; Ntrkr3; Tkt; Tyro10
|
||||
| Gene Name | Ddr2 | Gene ID | |||
| UniProt ID | |||||
| Family | Transferases (EC 2) | ||||
| EC Number | EC: 2.7.10.1 (Click to Show/Hide the Complete EC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MIPIPRMPLVLLLLLLILGSAKAQVNPAICRYPLGMSGGHIPDEDITASSQWSESTAAKY
GRLDSEEGDGAWCPEIPVQPDDLKEFLQIDLRTLHFITLVGTQGRHAGGHGIEFAPMYKI NYSRDGSRWISWRNRHGKQVLDGNSNPYDVFLKDLEPPIVARFVRLIPVTDHSMNVCMRV ELYGCVWLDGLVSYNAPAGQQFVLPGGSIIYLNDSVYDGAVGYSMTEGLGQLTDGVSGLD DFTQTHEYHVWPGYDYVGWRNESATNGFIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFK EVQCYFRSEASEWEPTAVYFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFS EITFQSDAAMYNNSGALPTSPMAPTTYDPMLKVDDSNTRILIGCLVAIIFILLAIIVIIL WRQFWQKMLEKASRRMLDDEMTVSLSLPSESSMFNNNRSSSPSEQESNSTYDRIFPLRPD YQEPSRLIRKLPEFAPGEEESGCSGVVKPAQPNGPEGVPHYAEADIVNLQGVTGGNTYCV PAVTMDLLSGKDVAVEEFPRKLLAFKEKLGEGQFGEVHLCEVEGMEKFKDKDFALDVSAN QPVLVAVKMLRADANKNARNDFLKEIKIMSRLKDPNIIRLLAVCITEDPLCMITEYMENG DLNQFLSRHEPLSSCSSDATVSYANLKFMATQIASGMKYLSSLNFVHRDLATRNCLVGKN YTIKIADFGMSRNLYSGDYYRIQGRAVLPIRWMSWESILLGKFTTASDVWAFGVTLWETF TFCQEQPYSQLSDEQVIENTGEFFRDQGRQIYLPQPALCPDSVYKLMLSCWRRETKHRPS FQEIHLLLLQQGAE |
||||
| Function | Tyrosine kinase that functions as cell surface receptor for fibrillar collagen and regulates cell differentiation, remodeling of the extracellular matrix, cell migration and cell proliferation. Required for normal bone development. Regulates osteoblast differentiation and chondrocyte maturation via a signaling pathway that involves MAP kinases and leads to the activation of the transcription factor RUNX2. Regulates remodeling of the extracellular matrix by up-regulation of the collagenases MMP1, MMP2 and MMP13, and thereby facilitates cell migration and tumor cell invasion. Promotes fibroblast migration and proliferation, and thereby contributes to cutaneous wound healing. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic oxygen compounds | ||||||
| Glucose | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Glucose (low concentration) addition (17.50 hours) | |||||
| Induced Change | DDR2 protein abundance levels: increase (FC = 1.70) | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Cerebral stroke [ICD-11: 8B11] | |||||
| Details | It is reported that low glucose addition causes the increase of DDR2 protein abundance compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Quantitative Proteomics Reveals the Beneficial Effects of Low Glucose on Neuronal Cell Survival in an in vitro Ischemic Penumbral Model. Front Cell Neurosci. 2020 Sep 1;14:272. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

