Details of Protein

General Information of Protein (ID: PRT00775)
Name TP53-regulated inhibitor of apoptosis 1 (TRIAP1)
Synonyms   Click to Show/Hide Synonyms of This Protein
Protein 15E1.1; WF-1; p53-inducible cell-survival factor; p53CSV; HSPC132; TRIAP1; 15E1.1
Gene Name TRIAP1 Gene ID
51499
UniProt ID
O43715
Family Chloroplast envelope erotein translocase (CEPT)
TC Number   TC: 3.A.9.1.1  (Click to Show/Hide the Complete TC Tree)
The Chloroplast Envelope Protein Translocase (CEPT or Tic-Toc) Family
.
TC: 3.A.9.1.1
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MNSVGEACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIPIE
GLEFMGHGKEKPENSS
Structure
4XZS ; 4XZV ; 6I3V ; 6I3Y ; 6I4Y
Function Involved in the modulation of the mitochondrial apoptotic pathway by ensuring the accumulation of cardiolipin (CL) in mitochondrial membranes. In vitro, the TRIAP1:PRELID1 complex mediates the transfer of phosphatidic acid (PA) between liposomes and probably functions as a PA transporter across the mitochondrion intermembrane space to provide PA for CL synthesis in the inner membrane. Likewise, the TRIAP1:PRELID3A complex mediates the transfer of phosphatidic acid (PA) between liposomes (in vitro) and probably functions as a PA transporter across the mitochondrion intermembrane space (in vivo). Mediates cell survival by inhibiting activation of caspase-9 which prevents induction of apoptosis.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Glutamine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glutamine addition (24 hours)
                      Induced Change TRIAP1 protein expression levels: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Colon cancer [ICD-11: 2B90]
                      Details It is reported that glutamine addition causes the decrease of TRIAP1 protein expression compared with control group.
References
1 Glutamine regulates the human epithelial intestinal HCT-8 cell proteome under apoptotic conditions. Mol Cell Proteomics. 2007 Oct;6(10):1671-9.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.