Details of Protein

General Information of Protein (ID: PRT00755)
Name V-type proton ATPase E (VMA4)
Synonyms   Click to Show/Hide Synonyms of This Protein
V-ATPase subunit E; V-ATPase 27 kDa subunit; Vacuolar proton pump subunit E; YOR332W; O6241; VMA4; VAT5
Gene Name VMA4 Gene ID
854509
UniProt ID
P22203
Family Translocating F/V/A-type ATPase (F-ATPase)
TC Number   TC: 3.A.2.2.3  (Click to Show/Hide the Complete TC Tree)
The H+- or Na+-translocating F-type, V-type and A-type ATPase (F-ATPase) Superfamily
.
TC: 3.A.2.2.3
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MSSAITALTPNQVNDELNKMQAFIRKEAEEKAKEIQLKADQEYEIEKTNIVRNETNNIDG
NFKSKLKKAMLSQQITKSTIANKMRLKVLSAREQSLDGIFEETKEKLSGIANNRDEYKPI
LQSLIVEALLKLLEPKAIVKALERDVDLIESMKDDIMREYGEKAQRAPLEEIVISNDYLN
KDLVSGGVVVSNASDKIEINNTLEERLKLLSEEALPAIRLELYGPSKTRKFFD
Structure
2KZ9 ; 3J9T ; 3J9U ; 3J9V ; 4DL0 ; 4EFA ; 5BW9 ; 5D80 ; 5VOX ; 5VOY ; 5VOZ ; 6O7V ; 6O7W ; 6O7X
Function Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Homogeneous non-metal compounds
            Nitrogen Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Nitrogen limitation (1.50 hours)
                      Induced Change VMA4 protein expression levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that nitrogen limitation causes the increase of VMA4 protein expression compared with control group.
References
1 Proteome analysis of yeast response to various nutrient limitations. Mol Syst Biol. 2006;2:2006.0026.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.