Details of Protein

General Information of Protein (ID: PRT00747)
Name Intercellular adhesion molecule 1 (ICAM1)
Synonyms   Click to Show/Hide Synonyms of This Protein
ICAM-1; Major group rhinovirus receptor; CD antigen CD54; ICAM1
Gene Name ICAM1 Gene ID
3383
UniProt ID
P05362
Family Basigin (BAS)
TC Number   TC: 8.A.23.4.1  (Click to Show/Hide the Complete TC Tree)
The Basigin Family
.
TC: 8.A.23.4.1
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGI
ETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAP
LPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHH
GANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLD
GLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQE
TLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKA
TPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQ
AWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE
IVIITVVAAAVIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP
Structure
1D3E ; 1D3I ; 1D3L ; 1IAM ; 1IC1 ; 1IJ4 ; 1MQ8 ; 1P53 ; 1Z7Z ; 2OZ4 ; 3TCX ; 5MZA ; 6EIT ; 6S8U
Function ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). During leukocyte trans-endothelial migration, ICAM1 engagement promotes the assembly of endothelial apical cups through ARHGEF26/SGEF and RHOG activation.; (Microbial infection) Acts as a receptor for major receptor group rhinovirus A-B capsid proteins.; (Microbial infection) Acts as a receptor for Coxsackievirus A21 capsid proteins.; (Microbial infection) Upon Kaposi's sarcoma-associated herpesvirus/HHV-8 infection, is degraded by viral E3 ubiquitin ligase MIR2, presumably to prevent lysis of infected cells by cytotoxic T-lymphocytes and NK cell.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Gamma-Glutamylvaline Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Gamma-Glutamylvaline addition (16 hours)
                      Induced Change ICAM1 protein expression levels: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Peritonitis [ICD-11: DC50]
                      Details It is reported that gamma-glutamylvaline addition causes the decrease of ICAM1 protein expression compared with control group.
References
1 Dietary -Glutamyl Valine Ameliorates TNF--Induced Vascular Inflammation via Endothelial Calcium-Sensing Receptors. J Agric Food Chem. 2020 Aug 26;68(34):9139-9149.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.