Details of Protein

General Information of Protein (ID: PRT00743)
Name Heat-responsive protein 12 (HRSP12)
Synonyms   Click to Show/Hide Synonyms of This Protein
14.5 kDa translational inhibitor protein; hp14.5; p14.5; Reactive intermediate imine deaminase A homolog; Translation inhibitor L-PSP ribonuclease; UK114 antigen homolog; RIDA; 2-iminobutanoate/2-iminopropanoate deaminase; RIDA
Gene Name RIDA Gene ID
10247
UniProt ID
P52758
Family Hydrolases (EC 3)
EC Number   EC: 3.5.99.10  (Click to Show/Hide the Complete EC Tree)
Hydrolases
Carbon-nitrogen hydrolase
Carbon-nitrogen hydrolase
EC: 3.5.99.10
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MSSLIRRVISTAKAPGAIGPYSQAVLVDRTIYISGQIGMDPSSGQLVSGGVAEEAKQALK
NMGEILKAAGCDFTNVVKTTVLLADINDFNTVNEIYKQYFKSNFPARAAYQVAALPKGSR
IEIEAVAIQGPLTTASL
Structure
1ONI
Function Catalyzes the hydrolytic deamination of enamine/imine intermediates that form during the course of normal metabolism. May facilitate the release of ammonia from these potentially toxic reactive metabolites, reducing their impact on cellular components. It may act on enamine/imine intermediates formed by several types of pyridoxal-5'-phosphate-dependent dehydratases including L-threonine dehydratase.; Also promotes endoribonucleolytic cleavage of some transcripts by promoting recruitment of the ribonuclease P/MRP complex. Acts by bridging YTHDF2 and the ribonuclease P/MRP complex. RIDA/HRSP12 binds to N6-methyladenosine (m6A)-containing mRNAs containing a 5'-GGUUC-3' motif: cooperative binding of RIDA/HRSP12 and YTHDF2 to such transcripts lead to recruitment of the ribonuclease P/MRP complex and subsequent endoribonucleolytic cleavage.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Glutamine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glutamine absence (16 hours)
                      Induced Change RIDA protein abundance levels: increase (FC = 8.02)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hepatocellular carcinoma [ICD-11: 2C12]
                      Details It is reported that glutamine absence causes the increase of RIDA protein abundance compared with control group.
References
1 Quantitative proteomics analysis reveals glutamine deprivation activates fatty acid -oxidation pathway in HepG2 cells. Amino Acids. 2016 May;48(5):1297-307.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.