Details of Protein

General Information of Protein (ID: PRT00740)
Name Cell division control protein 42 (CDC42)
Synonyms   Click to Show/Hide Synonyms of This Protein
Suppressor of RHO3 protein 2; YLR229C; L8083.13; CDC42; SRO2
Gene Name CDC42 Gene ID
850930
UniProt ID
P19073
Family Hydrolases (EC 3)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTVMIGDEPYTLGLFDTAG
QEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPGVPCLVVGTQIDLR
DDKVIIEKLQRQRLRPITSEQGSRLARELKAVKYVECSALTQRGLKNVFDEAIVAALEPP
VIKKSKKCAIL
Function Involved in development of cell polarity during the cell division cycle, and essential for bud emergence. Affects signaling in the pheromone-response pathway through the STE20 protein kinase. Negatively regulated by the GTPase-activating proteins RGA1, BEM3, and BEM4.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Homogeneous non-metal compounds
            Nitrogen Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Nitrogen limitation (1.50 hours)
                      Induced Change CDC42 protein expression levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that nitrogen limitation causes the increase of CDC42 protein expression compared with control group.
References
1 Proteome analysis of yeast response to various nutrient limitations. Mol Syst Biol. 2006;2:2006.0026.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.