Details of Protein

General Information of Protein (ID: PRT00738)
Name ZW10 interactor (ZWINT)
Synonyms   Click to Show/Hide Synonyms of This Protein
ZW10-interacting protein 1; Zwint-1; Zwint; D10Ertd749e
Gene Name Zwint Gene ID
52696
UniProt ID
Q9CQU5
Family Coiled-coil containing (CCC)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MADAEKNAVAEKNNAVATKEVLAEAAAILEPVGLQEEAELPAKIMEEFMRNSRKKDKLLC
SQLQVVNFLQTFLAQEDTEQSPDALASEDASRQKATETKEQWKDMKATYMDHVDVIKCAL
SEALPQVKEAHRKYTELQKAFEQLEAKKRVLEEKLQLAQKQWVLQQKRLQNLTKISAEVK
RRRKRALEKLDGSHQELETLKQQAGQEQEKLQRNQSYLQLLCSLQNKLVISEGKAEDKDV
KGRALTAKSKSP
Function Part of the MIS12 complex, which is required for kinetochore formation and spindle checkpoint activity. Required to target ZW10 to the kinetochore at prometaphase.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic oxygen compounds
            Glucose Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glucose (low concentration) addition (17.50 hours)
                      Induced Change ZWINT protein abundance levels: increase (FC = 1.51)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Cerebral stroke [ICD-11: 8B11]
                      Details It is reported that low glucose addition causes the increase of ZWINT protein abundance compared with control group.
References
1 Quantitative Proteomics Reveals the Beneficial Effects of Low Glucose on Neuronal Cell Survival in an in vitro Ischemic Penumbral Model. Front Cell Neurosci. 2020 Sep 1;14:272.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.