Details of Protein

General Information of Protein (ID: PRT00731)
Name Interferon-induced transmembrane protein 2 (IFITM2)
Synonyms   Click to Show/Hide Synonyms of This Protein
Dispanin subfamily A member 2c; DSPA2c; Interferon-inducible protein 1-8D; IFITM2
Gene Name IFITM2 Gene ID
10581
UniProt ID
Q01629
Family Dispanin (DIP)
TC Number   TC: 8.A.58.1.2  (Click to Show/Hide the Complete TC Tree)
The Dispanin Family
.
TC: 8.A.58.1.2
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MNHIVQTFSPVNSGQPPNYEMLKEEQEVAMLGVPHNPAPPMSTVIHIRSETSVPDHVVWS
LFNTLFMNTCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGIFMTILL
IIIPVLVVQAQR
Function IFN-induced antiviral protein which inhibits the entry of viruses to the host cell cytoplasm, permitting endocytosis, but preventing subsequent viral fusion and release of viral contents into the cytosol. Active against multiple viruses, including influenza A virus, SARS coronavirus (SARS-CoV), Marburg virus (MARV), Ebola virus (EBOV), Dengue virus (DNV), West Nile virus (WNV), human immunodeficiency virus type 1 (HIV-1) and vesicular stomatitis virus (VSV). Can inhibit: influenza virus hemagglutinin protein-mediated viral entry, MARV and EBOV GP1,2-mediated viral entry, SARS-CoV S protein-mediated viral entry and VSV G protein-mediated viral entry. Induces cell cycle arrest and mediates apoptosis by caspase activation and in p53-independent manner.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Glutamine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glutamine absence (16 hours)
                      Induced Change IFITM2 protein abundance levels: increase (FC = 1.74)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hepatocellular carcinoma [ICD-11: 2C12]
                      Details It is reported that glutamine absence causes the increase of IFITM2 protein abundance compared with control group.
References
1 Quantitative proteomics analysis reveals glutamine deprivation activates fatty acid -oxidation pathway in HepG2 cells. Amino Acids. 2016 May;48(5):1297-307.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.