Details of Protein

General Information of Protein (ID: PRT00730)
Name Regulator of G-protein signaling 20 (RGS20)
Synonyms   Click to Show/Hide Synonyms of This Protein
RGS20; Regulator of G-protein signaling Z1; Rgs20; Rgsz1
Gene Name Rgs20 Gene ID
58175
UniProt ID
Q9QZB1
Family G-protein signalling regulator (GPSR)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MRTANGGPRARASPSASPADPGLPEGSERTEMRMRQMCGGSETQGPAPSQQGGRGSNACC
FCWCCCCTCSCLTVRNQEDQRPQRASHEIRTDIPACEESPTPTLEEVCAWAQSFDNLMVT
PAGRNAFREFLRTEFSEENMLFWMACEELKREANKSTIEEKARIIYEDYISILSPKEVSL
DSRVREVINRNMVDPSQHIFDDAQLQIYTLMHRDSYPRFMNSTVYKDLLTSLAEKTVEA
Function Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds selectively to G(z)-alpha and G(alpha)-i2 subunits, accelerates their GTPase activity and regulates their signaling activities. The G(z)-alpha activity is inhibited by the phosphorylation and palmitoylation of the G-protein. Negatively regulates mu-opioid receptor-mediated activation of the G-proteins.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Methionine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Methionine decrease (504 hours)
                      Induced Change RGS20 protein expression levels: decrease (FC = 0.62)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Fatty liver disease [ICD-11: DB92]
                      Details It is reported that methionine decrease causes the decrease of RGS20 protein expression compared with control group.
References
1 Proteomic analysis of mice fed methionine and choline deficient diet reveals marker proteins associated with steatohepatitis. PLoS One. 2015 Apr 7;10(4):e0120577.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.