Details of Protein
General Information of Protein (ID: PRT00730) | |||||
---|---|---|---|---|---|
Name | Regulator of G-protein signaling 20 (RGS20) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
RGS20; Regulator of G-protein signaling Z1; Rgs20; Rgsz1
|
||||
Gene Name | Rgs20 | Gene ID | |||
UniProt ID | |||||
Family | G-protein signalling regulator (GPSR) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MRTANGGPRARASPSASPADPGLPEGSERTEMRMRQMCGGSETQGPAPSQQGGRGSNACC
FCWCCCCTCSCLTVRNQEDQRPQRASHEIRTDIPACEESPTPTLEEVCAWAQSFDNLMVT PAGRNAFREFLRTEFSEENMLFWMACEELKREANKSTIEEKARIIYEDYISILSPKEVSL DSRVREVINRNMVDPSQHIFDDAQLQIYTLMHRDSYPRFMNSTVYKDLLTSLAEKTVEA |
||||
Function | Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds selectively to G(z)-alpha and G(alpha)-i2 subunits, accelerates their GTPase activity and regulates their signaling activities. The G(z)-alpha activity is inhibited by the phosphorylation and palmitoylation of the G-protein. Negatively regulates mu-opioid receptor-mediated activation of the G-proteins. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Methionine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Methionine decrease (504 hours) | |||||
Induced Change | RGS20 protein expression levels: decrease (FC = 0.62) | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Fatty liver disease [ICD-11: DB92] | |||||
Details | It is reported that methionine decrease causes the decrease of RGS20 protein expression compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Proteomic analysis of mice fed methionine and choline deficient diet reveals marker proteins associated with steatohepatitis. PLoS One. 2015 Apr 7;10(4):e0120577. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.