Details of Protein
| General Information of Protein (ID: PRT00724) | |||||
|---|---|---|---|---|---|
| Name | Solute carrier family 19 member 2 (SLC19A2) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
ThTr-1; ThTr1; Solute carrier family 19 member 2; Thiamine carrier 1; TC1; SLC19A2; THT1; TRMA
|
||||
| Gene Name | SLC19A2 | Gene ID | |||
| UniProt ID | |||||
| Family | Reduced folate carrier (RFC) | ||||
| TC Number | TC: 2.A.48.1.2 (Click to Show/Hide the Complete TC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MDVPGPVSRRAAAAAATVLLRTARVRRECWFLPTALLCAYGFFASLRPSEPFLTPYLLGP
DKNLTEREVFNEIYPVWTYSYLVLLFPVFLATDYLRYKPVVLLQGLSLIVTWFMLLYAQG LLAIQFLEFFYGIATATEIAYYSYIYSVVDLGMYQKVTSYCRSATLVGFTVGSVLGQILV SVAGWSLFSLNVISLTCVSVAFAVAWFLPMPQKSLFFHHIPSTCQRVNGIKVQNGGIVTD TPASNHLPGWEDIESKIPLNMEEPPVEEPEPKPDRLLVLKVLWNDFLMCYSSRPLLCWSV WWALSTCGYFQVVNYTQGLWEKVMPSRYAAIYNGGVEAVSTLLGAVAVFAVGYIKISWST WGEMTLSLFSLLIAAAVYIMDTVGNIWVCYASYVVFRIIYMLLITIATFQIAANLSMERY ALVFGVNTFIALALQTLLTLIVVDASGLGLEITTQFLIYASYFALIAVVFLASGAVSVMK KCRKLEDPQSSSQVTTS |
||||
| Function | High-affinity transporter for the intake of thiamine. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulated by This Protein | ||||||
|---|---|---|---|---|---|---|
| Organoheterocyclic compounds | ||||||
| Thiamine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Overexpression of SLC19A2 | |||||
| Induced Change | Thiamine concentration: increase (FC = 5) | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | TRMA syndrome [ICD-11: 5C63] | |||||
| Details | It is reported that overexpression of SLC19A2 leads to the increase of thiamine levels compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | The gene mutated in thiamine-responsive anaemia with diabetes and deafness (TRMA) encodes a functional thiamine transporter. Nat Genet. 1999 Jul;22(3):305-8. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

