Details of Protein
General Information of Protein (ID: PRT00705) | |||||
---|---|---|---|---|---|
Name | Solute carrier family 16 member 7 (SLC16A7) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
MCT 2; Monocarboxylate transporter 2; SLC16A7; MCT2
|
||||
Gene Name | SLC16A7 | Gene ID | |||
UniProt ID | |||||
Family | Monocarboxylate porter (MNP) | ||||
TC Number | TC: 2.A.1.13.5 (Click to Show/Hide the Complete TC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MPPMPSAPPVHPPPDGGWGWIVVGAAFISIGFSYAFPKAVTVFFKEIQQIFHTTYSEIAW
ISSIMLAVMYAGGPVSSVLVNKYGSRPVVIAGGLLCCLGMVLASFSSSVVQLYLTMGFIT GLGLAFNLQPALTIIGKYFYRKRPMANGLAMAGSPVFLSSLAPFNQYLFNTFGWKGSFLI LGSLLLNACVAGSLMRPLGPNQTTSKSKNKTGKTEDDSSPKKIKTKKSTWEKVNKYLDFS LFKHRGFLIYLSGNVIMFLGFFAPIIFLAPYAKDQGIDEYSAAFLLSVMAFVDMFARPSV GLIANSKYIRPRIQYFFSFAIMFNGVCHLLCPLAQDYTSLVLYAVFFGLGFGSVSSVLFE TLMDLVGAPRFSSAVGLVTIVECGPVLLGPPLAGKLVDLTGEYKYMYMSCGAIVVAASVW LLIGNAINYRLLAKERKEENARQKTRESEPLSKSKHSEDVNVKVSNAQSVTSERETNI |
||||
Structure | |||||
Function | Proton-coupled monocarboxylate transporter. Catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate. Functions as high-affinity pyruvate transporter. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulated by This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Lactic acid | Click to Show/Hide the Full List of Regulating Pair(s): 2 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair (1) |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Knockout of SLC16A7 | |||||
Induced Change | Lactic acid concentration: decrease | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Breast cancer [ICD-11: 2C60] | |||||
Details | It is reported that knockout of SLC16A7 leads to the decrease of lactic acid levels compared with control group. | |||||
Regulating Pair (2) |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Inhibition (AR-C155858) of SLC16A7 | |||||
Induced Change | Lactic acid concentration: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Breast cancer [ICD-11: 2C60] | |||||
Details | It is reported that inhibition of SLC16A7 leads to the increase of lactic acid levels compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Monocarboxylate transporter 4 (MCT4) is a high affinity transporter capable of exporting lactate in high-lactate microenvironments. J Biol Chem. 2019 Dec 27;294(52):20135-20147. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.