Details of Protein

General Information of Protein (ID: PRT00705)
Name Solute carrier family 16 member 7 (SLC16A7)
Synonyms   Click to Show/Hide Synonyms of This Protein
MCT 2; Monocarboxylate transporter 2; SLC16A7; MCT2
Gene Name SLC16A7 Gene ID
9194
UniProt ID
O60669
Family Monocarboxylate porter (MNP)
TC Number   TC: 2.A.1.13.5  (Click to Show/Hide the Complete TC Tree)
The Major Facilitator Superfamily (MFS)
The Monocarboxylate Transporter (MCT) Family
TC: 2.A.1.13.5
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MPPMPSAPPVHPPPDGGWGWIVVGAAFISIGFSYAFPKAVTVFFKEIQQIFHTTYSEIAW
ISSIMLAVMYAGGPVSSVLVNKYGSRPVVIAGGLLCCLGMVLASFSSSVVQLYLTMGFIT
GLGLAFNLQPALTIIGKYFYRKRPMANGLAMAGSPVFLSSLAPFNQYLFNTFGWKGSFLI
LGSLLLNACVAGSLMRPLGPNQTTSKSKNKTGKTEDDSSPKKIKTKKSTWEKVNKYLDFS
LFKHRGFLIYLSGNVIMFLGFFAPIIFLAPYAKDQGIDEYSAAFLLSVMAFVDMFARPSV
GLIANSKYIRPRIQYFFSFAIMFNGVCHLLCPLAQDYTSLVLYAVFFGLGFGSVSSVLFE
TLMDLVGAPRFSSAVGLVTIVECGPVLLGPPLAGKLVDLTGEYKYMYMSCGAIVVAASVW
LLIGNAINYRLLAKERKEENARQKTRESEPLSKSKHSEDVNVKVSNAQSVTSERETNI
Structure
7BP3
Function Proton-coupled monocarboxylate transporter. Catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate. Functions as high-affinity pyruvate transporter.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Organic acids and derivatives
            Lactic acid Click to Show/Hide the Full List of Regulating Pair(s):   2 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Knockout of SLC16A7
                      Induced Change Lactic acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Breast cancer [ICD-11: 2C60]
                      Details It is reported that knockout of SLC16A7 leads to the decrease of lactic acid levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Inhibition (AR-C155858) of SLC16A7
                      Induced Change Lactic acid concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Breast cancer [ICD-11: 2C60]
                      Details It is reported that inhibition of SLC16A7 leads to the increase of lactic acid levels compared with control group.
References
1 Monocarboxylate transporter 4 (MCT4) is a high affinity transporter capable of exporting lactate in high-lactate microenvironments. J Biol Chem. 2019 Dec 27;294(52):20135-20147.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.