Details of Protein

General Information of Protein (ID: PRT00689)
Name Succinate receptor (SUCNR1)
Synonyms   Click to Show/Hide Synonyms of This Protein
G-protein coupled receptor 91; P2Y purinoceptor 1-like; SUCNR1; GPR91
Gene Name SUCNR1 Gene ID
56670
UniProt ID
Q9BXA5
Family GPCR rhodopsin (GPCR-1)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MLGIMAWNATCKNWLAAEAALEKYYLSIFYGIEFVVGVLGNTIVVYGYIFSLKNWNSSNI
YLFNLSVSDLAFLCTLPMLIRSYANGNWIYGDVLCISNRYVLHANLYTSILFLTFISIDR
YLIIKYPFREHLLQKKEFAILISLAIWVLVTLELLPILPLINPVITDNGTTCNDFASSGD
PNYNLIYSMCLTLLGFLIPLFVMCFFYYKIALFLKQRNRQVATALPLEKPLNLVIMAVVI
FSVLFTPYHVMRNVRIASRLGSWKQYQCTQVVINSFYIVTRPLAFLNSVINPVFYFLLGD
HFRDMLMNQLRHNFKSLTSFSRWAHELLLSFREK
Function Receptor for succinate.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Maleic acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Maleic acid addition (1 hours)
                      Induced Change SUCNR1 protein activity levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that maleic acid addition causes the increase of SUCNR1 protein activity compared with control group.
            Succinic acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Succinic acid addition (1 hours)
                      Induced Change SUCNR1 protein activity levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that succinic acid addition causes the increase of SUCNR1 protein activity compared with control group.
References
1 Identification and pharmacological characterization of succinate receptor agonists. Br J Pharmacol. 2017 May;174(9):796-808.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.