Details of Protein

General Information of Protein (ID: PRT00681)
Name Oxoglutarate receptor (OXGR1)
Synonyms   Click to Show/Hide Synonyms of This Protein
Alpha-ketoglutarate receptor 1; G-protein coupled receptor 80; G-protein coupled receptor 99; P2Y purinoceptor 15; P2Y15; P2Y-like GPCR; P2Y-like nucleotide receptor; OXGR1; GPR80; GPR99; P2RY15; P2Y15
Gene Name OXGR1 Gene ID
27199
UniProt ID
Q96P68
Family GPCR rhodopsin (GPCR-1)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MNEPLDYLANASDFPDYAAAFGNCTDENIPLKMHYLPVIYGIIFLVGFPGNAVVISTYIF
KMRPWKSSTIIMLNLACTDLLYLTSLPFLIHYYASGENWIFGDFMCKFIRFSFHFNLYSS
ILFLTCFSIFRYCVIIHPMSCFSIHKTRCAVVACAVVWIISLVAVIPMTFLITSTNRTNR
SACLDLTSSDELNTIKWYNLILTATTFCLPLVIVTLCYTTIIHTLTHGLQTDSCLKQKAR
RLTILLLLAFYVCFLPFHILRVIRIESRLLSISCSIENQIHEAYIVSRPLAALNTFGNLL
LYVVVSDNFQQAVCSTVRCKVSGNLEQAKKISYSNNP
Function Receptor for alpha-ketoglutarate. Seems to act exclusively through a G(q)-mediated pathway.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Oxoglutaric acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Oxoglutaric acid addition (336 hours)
                      Induced Change OXGR1 protein activity levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that oxoglutaric acid addition causes the increase of OXGR1 protein activity compared with control group.
References
1 Citric acid cycle intermediates as ligands for orphan G-protein-coupled receptors. Nature. 2004 May 13;429(6988):188-93.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.