Details of Protein
| General Information of Protein (ID: PRT00668) | |||||
|---|---|---|---|---|---|
| Name | G-protein coupled receptor 78 (GPR78) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
UNQ5925/PRO19818; GPR78
|
||||
| Gene Name | GPR78 | Gene ID | |||
| UniProt ID | |||||
| Family | GPCR rhodopsin (GPCR-1) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MGPGEALLAGLLVMVLAVALLSNALVLLCCAYSAELRTRASGVLLVNLSLGHLLLAALDM
PFTLLGVMRGRTPSAPGACQVIGFLDTFLASNAALSVAALSADQWLAVGFPLRYAGRLRP RYAGLLLGCAWGQSLAFSGAALGCSWLGYSSAFASCSLRLPPEPERPRFAAFTATLHAVG FVLPLAVLCLTSLQVHRVARRHCQRMDTVTMKALALLADLHPSVRQRCLIQQKRRRHRAT RKIGIAIATFLICFAPYVMTRLAELVPFVTVNAQWGILSKCLTYSKAVADPFTYSLLRRP FRQVLAGMVHRLLKRTPRPASTHDSSLDVAGMVHQLLKRTPRPASTHNGSVDTENDSCLQ QTH |
||||
| Function | Orphan receptor. Displays a significant level of constitutive activity. Its effect is mediated by G(s)-alpha protein that stimulate adenylate cyclase, resulting in an elevation of intracellular cAMP. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| Arginine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
 click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Arginine decrease (48 hours) | |||||
| Induced Change | GPR78 protein abundance levels: increase | |||||
| Summary | Introduced Variation
Induced Change
|
|||||
| Disease Status | Brain cancer [ICD-11: 2A00] | |||||
| Details | It is reported that arginine decrease causes the increase of GPR78 protein abundance compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Combinatory Treatment of Canavanine and Arginine Deprivation Efficiently Targets Human Glioblastoma Cells via Pleiotropic Mechanisms. Cells. 2020 Sep 30;9(10):2217. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.