Details of Protein

General Information of Protein (ID: PRT00643)
Name Chemerin receptor (CMKLR1)
Synonyms   Click to Show/Hide Synonyms of This Protein
G-protein coupled receptor ChemR23; G-protein coupled receptor DEZ; CMKLR1; CHEMR23; DEZ
Gene Name CMKLR1 Gene ID
1240
UniProt ID
Q99788
Family GPCR rhodopsin (GPCR-1)
TC Number   TC: 9.A.14.13.15  (Click to Show/Hide the Complete TC Tree)
The G-protein-coupled receptor (GPCR) Family
.
TC: 9.A.14.13.15
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MRMEDEDYNTSISYGDEYPDYLDSIVVLEDLSPLEARVTRIFLVVVYSIVCFLGILGNGL
VIIIATFKMKKTVNMVWFLNLAVADFLFNVFLPIHITYAAMDYHWVFGTAMCKISNFLLI
HNMFTSVFLLTIISSDRCISVLLPVWSQNHRSVRLAYMACMVIWVLAFFLSSPSLVFRDT
ANLHGKISCFNNFSLSTPGSSSWPTHSQMDPVGYSRHMVVTVTRFLCGFLVPVLIITACY
LTIVCKLQRNRLAKTKKPFKIIVTIIITFFLCWCPYHTLNLLELHHTAMPGSVFSLGLPL
ATALAIANSCMNPILYVFMGQDFKKFKVALFSRLVNALSEDTGHSSYPSHRSFTKMSSMN
ERTSMNERETGML
Function Receptor for the chemoattractant adipokine chemerin/RARRES2 and for the omega-3 fatty acid derived molecule resolvin E1. Interaction with RARRES2 induces activation of intracellular signaling molecules, such as SKY, MAPK1/3 (ERK1/2), MAPK14/P38MAPK and PI3K leading to multifunctional effects, like, reduction of immune responses, enhancing of adipogenesis and angionesis. Resolvin E1 down-regulates cytokine production in macrophages by reducing the activation of MAPK1/3 (ERK1/2) and NF-kappa-B. Positively regulates adipogenesis and adipocyte metabolism. Acts as a coreceptor for several SIV strains (SIVMAC316, SIVMAC239, SIVMACL7E-FR and SIVSM62A), as well as a primary HIV-1 strain (92UG024-2).
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Lipids and lipid-like molecules
            Resolvin E1 Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Resolvin E1 addition (24 hours)
                      Induced Change CMKLR1 protein phosphorylation levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Pneumonia [ICD-11: CA40]
                      Details It is reported that resolvin E1 addition causes the increase of CMKLR1 protein phosphorylation compared with control group.
References
1 Stereochemical assignment, antiinflammatory properties, and receptor for the omega-3 lipid mediator resolvin E1. J Exp Med. 2005 Mar 7;201(5):713-22.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.