Details of Protein
| General Information of Protein (ID: PRT00623) | |||||
|---|---|---|---|---|---|
| Name | Solute carrier family 38 member 4 (SLC38A4) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
Amino acid transporter A3; Na(+)-coupled neutral amino acid transporter 4; Solute carrier family 38 member 4; System A amino acid transporter 3; Slc38a4; Ata3; Nat3; Snat4
|
||||
| Gene Name | Slc38a4 | Gene ID | |||
| UniProt ID | |||||
| Family | Amino acid/polyamine transporter (AAPT) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MDPMELNNVSIEPDGDSCSGDSIQDSYTGMENSDKDAMNSQFANEDAESQKFLTNGFLGK
KKLADYADEHHPGMTSFGMSSFNLSNAIMGSGILGLSYAMANTGIILFIIMLLTVAILSL YSVHLLLKTAKEGGSLIYEKLGEKAFGWPGKIGAFISITMQNIGAMSSYLFIIKYELPEV IRAFMGLEENTGEWYLNGNYLVLFVSVGIILPLSLLKNLGYLGYTSGFSLSCMVFFVSVV IYKKFQIPCPLPALDHNNGNLTFNNTLPIHMISLPNDSESSGVNFMMDYAHHNPAGLDEK QVAGPLHSNGVEYEAQGAEKCQPKYFVFNSRTAYAIPILAFAFVCHPEVLPIYSELKDRS RRKMQTVSNISISGMLVMYLLAALFGYLSFYGDVEDELLHAYSKVYTFDTALLMVRLAVL VAVTLTVPIVLFPIRTSVITLLFPRKPFSWLKHFGIAAIIIALNNILVILVPTIKYIFGF IGASSATMLIFILPAAFYLKLVKKEPLRSPQKIGALVFLVTGIIFMMGSMALIILDWIYN PPNPNHH |
||||
| Function | Sodium-dependent amino acid transporter. Mediates electrogenic symport of neutral amino acids and sodium ions. Has a broad specificity, with a preference for Ala, followed by Ser, His, Gly, Cys, Asn, Thr, Pro, Gln and Met. May mediate sodium-independent transport of cationic amino acids, such as Arg and Lys. Amino acid uptake is pH-dependent, with lower transport activities at pH 6.5, intermediate at pH 7.0 and highest between pH 7.5 and 8.5. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic oxygen compounds | ||||||
| Glucose | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Glucose (low concentration) addition (17.50 hours) | |||||
| Induced Change | SLC38A4 protein abundance levels: decrease (FC = 2.55) | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Cerebral stroke [ICD-11: 8B11] | |||||
| Details | It is reported that low glucose addition causes the decrease of SLC38A4 protein abundance compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Quantitative Proteomics Reveals the Beneficial Effects of Low Glucose on Neuronal Cell Survival in an in vitro Ischemic Penumbral Model. Front Cell Neurosci. 2020 Sep 1;14:272. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

