Details of Protein

General Information of Protein (ID: PRT00623)
Name Solute carrier family 38 member 4 (SLC38A4)
Synonyms   Click to Show/Hide Synonyms of This Protein
Amino acid transporter A3; Na(+)-coupled neutral amino acid transporter 4; Solute carrier family 38 member 4; System A amino acid transporter 3; Slc38a4; Ata3; Nat3; Snat4
Gene Name Slc38a4 Gene ID
69354
UniProt ID
Q8R1S9
Family Amino acid/polyamine transporter (AAPT)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MDPMELNNVSIEPDGDSCSGDSIQDSYTGMENSDKDAMNSQFANEDAESQKFLTNGFLGK
KKLADYADEHHPGMTSFGMSSFNLSNAIMGSGILGLSYAMANTGIILFIIMLLTVAILSL
YSVHLLLKTAKEGGSLIYEKLGEKAFGWPGKIGAFISITMQNIGAMSSYLFIIKYELPEV
IRAFMGLEENTGEWYLNGNYLVLFVSVGIILPLSLLKNLGYLGYTSGFSLSCMVFFVSVV
IYKKFQIPCPLPALDHNNGNLTFNNTLPIHMISLPNDSESSGVNFMMDYAHHNPAGLDEK
QVAGPLHSNGVEYEAQGAEKCQPKYFVFNSRTAYAIPILAFAFVCHPEVLPIYSELKDRS
RRKMQTVSNISISGMLVMYLLAALFGYLSFYGDVEDELLHAYSKVYTFDTALLMVRLAVL
VAVTLTVPIVLFPIRTSVITLLFPRKPFSWLKHFGIAAIIIALNNILVILVPTIKYIFGF
IGASSATMLIFILPAAFYLKLVKKEPLRSPQKIGALVFLVTGIIFMMGSMALIILDWIYN
PPNPNHH
Function Sodium-dependent amino acid transporter. Mediates electrogenic symport of neutral amino acids and sodium ions. Has a broad specificity, with a preference for Ala, followed by Ser, His, Gly, Cys, Asn, Thr, Pro, Gln and Met. May mediate sodium-independent transport of cationic amino acids, such as Arg and Lys. Amino acid uptake is pH-dependent, with lower transport activities at pH 6.5, intermediate at pH 7.0 and highest between pH 7.5 and 8.5.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic oxygen compounds
            Glucose Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glucose (low concentration) addition (17.50 hours)
                      Induced Change SLC38A4 protein abundance levels: decrease (FC = 2.55)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Cerebral stroke [ICD-11: 8B11]
                      Details It is reported that low glucose addition causes the decrease of SLC38A4 protein abundance compared with control group.
References
1 Quantitative Proteomics Reveals the Beneficial Effects of Low Glucose on Neuronal Cell Survival in an in vitro Ischemic Penumbral Model. Front Cell Neurosci. 2020 Sep 1;14:272.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.