Details of Protein

General Information of Protein (ID: PRT00615)
Name Cellular retinoic acid-binding 2 (CRABP2)
Synonyms   Click to Show/Hide Synonyms of This Protein
Cellular retinoic acid-binding protein II; CRABP-II; CRABP2
Gene Name CRABP2 Gene ID
1382
UniProt ID
P29373
Family Fatty acid binding protein (FABP)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVR
TTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGEL
ILTMTADDVVCTRVYVRE
Structure
1BLR ; 1BM5 ; 1CBQ ; 1CBS ; 1XCA ; 2CBS ; 2FR3 ; 2FRS ; 2FS6 ; 2FS7 ; 2G78 ; 2G79 ; 2G7B ; 3CBS ; 3CR6 ; 3CWK ; 3D95 ; 3D96 ; 3D97 ; 3F8A ; 3F9D ; 3FA6 ; 3FA7 ; 3FA8 ; 3FA9 ; 3FEK ; 3FEL ; 3FEN ; 3FEP ; 3I17 ; 4I9R ; 4I9S ; 4M6S ; 4M7M ; 4QGV ; 4QGW ; 4QGX ; 4YBP ; 4YBU ; 4YCE ; 4YCH ; 4YDA ; 4YDB ; 4YFP ; 4YFQ ; 4YFR ; 4YGG ; 4YGH ; 4YGZ ; 4YH0 ; 4YKM ; 4YKO ; 5HZQ ; 5OGB ; 6HKR ; 6MOP ; 6MOQ ; 6MOR ; 6MOV ; 6MOW ; 6MOX ; 6MPK ; 6MQI ; 6MQJ ; 6MQW ; 6MQX ; 6MQY ; 6MQZ ; 6MR0 ; 6NNX ; 6NNY ; 6NOE
Function Transports retinoic acid to the nucleus. Regulates the access of retinoic acid to the nuclear retinoic acid receptors.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Arginine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Arginine decrease (48 hours)
                      Induced Change CRABP2 protein expression levels: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Colon cancer [ICD-11: 2B90]
                      Details It is reported that arginine decrease causes the decrease of CRABP2 protein expression compared with control group.
References
1 Arginine deficiency in preconfluent intestinal Caco-2 cells modulates expression of proteins involved in proliferation, apoptosis, and heat shock response. Proteomics. 2007 Feb;7(4):565-577.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.