Details of Protein

General Information of Protein (ID: PRT00602)
Name Growth arrest-specific protein 1 (GAS1)
Synonyms   Click to Show/Hide Synonyms of This Protein
GAS-1; Gas1; Gas-1
Gene Name Gas1 Gene ID
14451
UniProt ID
Q01721
Family Growth arrest-specific protein (GASP)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MLAALLGGAGARTGTLPGALLCLMALLQLLCSAPRGSGLAHGRRLICWQALLQCQGEPDC
SYAYSQYAEACAPVLAQRGGADAPGPAGAFPASAASSPRWRCPSHCISALIQLNHTRRGP
ALEDCDCAQDEHCRSTKRAIEPCLPRTSSVGPGAGAGSVMGCTEARRRCDRDSRCNLALS
RYLAYCGKLFNGLRCTDECRAVIEDMLAVPKAALLNDCVCDGLERPICESVKENMARLCF
GPDASNGPGSSGSDGGLDDYYDEEYDDEQRAGAAGGEQPLDDDDGLARPGGGAAAAGGRG
DLPHGPGRRSSSSGSGGHWANRSAWTPFACLLLLLLLLLGSHL
Function Specific growth arrest protein involved in growth suppression. Blocks entry to S phase. Prevents cycling of normal and transformed cells.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic oxygen compounds
            Glucose Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glucose (low concentration) addition (17.50 hours)
                      Induced Change GAS1 protein abundance levels: increase (FC = 1.90)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Cerebral stroke [ICD-11: 8B11]
                      Details It is reported that low glucose addition causes the increase of GAS1 protein abundance compared with control group.
References
1 Quantitative Proteomics Reveals the Beneficial Effects of Low Glucose on Neuronal Cell Survival in an in vitro Ischemic Penumbral Model. Front Cell Neurosci. 2020 Sep 1;14:272.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.