Details of Protein

General Information of Protein (ID: PRT00581)
Name L-type amino acid transporter 3 (LAT3)
Synonyms   Click to Show/Hide Synonyms of This Protein
Large neutral amino acids transporter small subunit 3; Prostate cancer overexpressed gene 1 protein; Solute carrier family 43 member 1; SLC43A1; LAT3; PB39; POV1
Gene Name SLC43A1 Gene ID
8501
UniProt ID
O75387
Family Amino acid/polyamine transporter (AAPT)
TC Number   TC: 2.A.1.44.1  (Click to Show/Hide the Complete TC Tree)
The Major Facilitator Superfamily (MFS)
The L-Amino Acid Transporter-3 (LAT3) Family
TC: 2.A.1.44.1
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MAPTLQQAYRRRWWMACTAVLENLFFSAVLLGWGSLLIILKNEGFYSSTCPAESSTNTTQ
DEQRRWPGCDQQDEMLNLGFTIGSFVLSATTLPLGILMDRFGPRPVRLVGSACFTASCTL
MALASRDVEALSPLIFLALSLNGFGGICLTFTSLTLPNMFGNLRSTLMALMIGSYASSAI
TFPGIKLIYDAGVAFVVIMFTWSGLACLIFLNCTLNWPIEAFPAPEEVNYTKKIKLSGLA
LDHKVTGDLFYTHVTTMGQRLSQKAPSLEDGSDAFMSPQDVRGTSENLPERSVPLRKSLC
SPTFLWSLLTMGMTQLRIIFYMAAVNKMLEYLVTGGQEHETNEQQQKVAETVGFYSSVFG
AMQLLCLLTCPLIGYIMDWRIKDCVDAPTQGTVLGDARDGVATKSIRPRYCKIQKLTNAI
SAFTLTNLLLVGFGITCLINNLHLQFVTFVLHTIVRGFFHSACGSLYAAVFPSNHFGTLT
GLQSLISAVFALLQQPLFMAMVGPLKGEPFWVNLGLLLFSLLGFLLPSYLFYYRARLQQE
YAANGMGPLKVLSGSEVTA
Function Sodium-independent, high affinity transport of large neutral amino acids. Has narrower substrate selectivity compared to SLC7A5 and SLC7A8 and mainly transports branched-chain amino acids and phenylalanine. Plays a role in the development of human prostate cancer, from prostatic intraepithelial neoplasia to invasive prostate cancer.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Organic acids and derivatives
            Iodotyrosine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of SLC43A1
                      Induced Change Iodotyrosine concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of SLC43A1 leads to the decrease of iodotyrosine levels compared with control group.
            Leucine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Overexpression of SLC43A1
                      Induced Change Leucine concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that overexpression of SLC43A1 leads to the decrease of leucine levels compared with control group.
References
1 Transport of Iodothyronines by Human L-Type Amino Acid Transporters. Endocrinology. 2015 Nov;156(11):4345-55.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.