Details of Protein
General Information of Protein (ID: PRT00578) | |||||
---|---|---|---|---|---|
Name | Solute carrier family 17 member 9 (SLC17A9) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
SLC17A9; C20orf59
|
||||
Gene Name | SLC17A9 | Gene ID | |||
UniProt ID | |||||
Family | Sodium/anion cotransporter (SAC) | ||||
TC Number | TC: 2.A.1.14.21 (Click to Show/Hide the Complete TC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MQPPPDEARRDMAGDTQWSRPECQAWTGTLLLGTCLLYCARSSMPICTVSMSQDFGWNKK
EAGIVLSSFFWGYCLTQVVGGHLGDRIGGEKVILLSASAWGSITAVTPLLAHLSSAHLAF MTFSRILMGLLQGVYFPALTSLLSQKVRESERAFTYSIVGAGSQFGTLLTGAVGSLLLEW YGWQSIFYFSGGLTLLWVWYVYRYLLSEKDLILALGVLAQSRPVSRHNRVPWRRLFRKPA VWAAVVSQLSAACSFFILLSWLPTFFEETFPDAKGWIFNVVPWLVAIPASLFSGFLSDHL INQGYRAITVRKLMQGMGLGLSSVFALCLGHTSSFCESVVFASASIGLQTFNHSGISVNI QDLAPSCAGFLFGVANTAGALAGVVGVCLGGYLMETTGSWTCLFNLVAIISNLGLCTFLV FGQAQRVDLSSTHEDL |
||||
Function | Involved in vesicular storage and exocytosis of ATP. May accumulate ATP and other nucleotides in secretory vesicles such as adrenal chromaffin granules and synaptic vesicles. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulated by This Protein | ||||||
---|---|---|---|---|---|---|
Nucleosides, nucleotides, and analogues | ||||||
ATP | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Knockdown (siRNA) of SLC17A9 | |||||
Induced Change | ATP concentration: decrease (FC = 0.50) | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Adrenomedullary hyperfunction [ICD-11: 5A75] | |||||
Details | It is reported that knockdown of SLC17A9 leads to the decrease of ATP levels compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Identification of a vesicular nucleotide transporter. Proc Natl Acad Sci U S A. 2008 Apr 15;105(15):5683-6. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.