Details of Protein
| General Information of Protein (ID: PRT00578) | |||||
|---|---|---|---|---|---|
| Name | Solute carrier family 17 member 9 (SLC17A9) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
SLC17A9; C20orf59
|
||||
| Gene Name | SLC17A9 | Gene ID | |||
| UniProt ID | |||||
| Family | Sodium/anion cotransporter (SAC) | ||||
| TC Number | TC: 2.A.1.14.21 (Click to Show/Hide the Complete TC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MQPPPDEARRDMAGDTQWSRPECQAWTGTLLLGTCLLYCARSSMPICTVSMSQDFGWNKK
EAGIVLSSFFWGYCLTQVVGGHLGDRIGGEKVILLSASAWGSITAVTPLLAHLSSAHLAF MTFSRILMGLLQGVYFPALTSLLSQKVRESERAFTYSIVGAGSQFGTLLTGAVGSLLLEW YGWQSIFYFSGGLTLLWVWYVYRYLLSEKDLILALGVLAQSRPVSRHNRVPWRRLFRKPA VWAAVVSQLSAACSFFILLSWLPTFFEETFPDAKGWIFNVVPWLVAIPASLFSGFLSDHL INQGYRAITVRKLMQGMGLGLSSVFALCLGHTSSFCESVVFASASIGLQTFNHSGISVNI QDLAPSCAGFLFGVANTAGALAGVVGVCLGGYLMETTGSWTCLFNLVAIISNLGLCTFLV FGQAQRVDLSSTHEDL |
||||
| Function | Involved in vesicular storage and exocytosis of ATP. May accumulate ATP and other nucleotides in secretory vesicles such as adrenal chromaffin granules and synaptic vesicles. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulated by This Protein | ||||||
|---|---|---|---|---|---|---|
| Nucleosides, nucleotides, and analogues | ||||||
| ATP | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Knockdown (siRNA) of SLC17A9 | |||||
| Induced Change | ATP concentration: decrease (FC = 0.50) | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Adrenomedullary hyperfunction [ICD-11: 5A75] | |||||
| Details | It is reported that knockdown of SLC17A9 leads to the decrease of ATP levels compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Identification of a vesicular nucleotide transporter. Proc Natl Acad Sci U S A. 2008 Apr 15;105(15):5683-6. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

