Details of Protein

General Information of Protein (ID: PRT00573)
Name Solute carrier family 13 member 2 (SLC13A2)
Synonyms   Click to Show/Hide Synonyms of This Protein
Na(+)/dicarboxylate cotransporter 1; NaDC-1; Renal sodium/dicarboxylate cotransporter; SLC13A2; NADC1; SDCT1
Gene Name SLC13A2 Gene ID
9058
UniProt ID
Q13183
Family Divalent anion:Na symporter (DASS)
TC Number   TC: 2.A.47.1.17  (Click to Show/Hide the Complete TC Tree)
The Divalent Anion:Na+ Symporter (DASS) Family
.
TC: 2.A.47.1.17
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MATCWQALWAYRSYLIVFFVPILLLPLPILVPSKEAYCAYAIILMALFWCTEALPLAVTA
LFPLILFPMMGIVDASEVAVEYLKDSNLLFFGGLLVAIAVEHWNLHKRIALRVLLIVGVR
PAPLILGFMLVTAFLSMWISNTATSAMMVPIAHAVLDQLHSSQASSNVEEGSNNPTFELQ
EPSPQKEVTKLDNGQALPVTSASSEGRAHLSQKHLHLTQCMSLCVCYSASIGGIATLTGT
APNLVLQGQINSLFPQNGNVVNFASWFSFAFPTMVILLLLAWLWLQILFLGFNFRKNFGI
GEKMQEQQQAAYCVIQTEHRLLGPMTFAEKAISILFVILVLLWFTREPGFFLGWGNLAFP
NAKGESMVSDGTVAIFIGIIMFIIPSKFPGLTQDPENPGKLKAPLGLLDWKTVNQKMPWN
IVLLLGGGYALAKGSERSGLSEWLGNKLTPLQSVPAPAIAIILSLLVATFTECTSNVATT
TIFLPILASMAQAICLHPLYVMLPCTLATSLAFMLPVATPPNAIVFSFGDLKVLDMARAG
FLLNIIGVLIIALAINSWGIPLFSLHSFPSWAQSNTTAQCLPSLANTTTPSP
Function Cotransport of sodium ions and dicarboxylates such as succinate and citrate.
Regulatory Network
Full List of Metabolite(s) Regulated by This Protein
      Lipid-related molecules
            Glutarate Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (Y432C) of SLC13A2
                      Induced Change Glutarate concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (Y432C) of SLC13A2 leads to the decrease of glutarate levels compared with control group.
      Organic acids and derivatives
            Citric acid Click to Show/Hide the Full List of Regulating Pair(s):   4 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Inhibition (BI01383298) of SLC13A2
                      Induced Change Citric acid concentration: decrease (FC = 0.40)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that inhibition (BI01383298) of SLC13A2 leads to the decrease of citric acid levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (T86C) of SLC13A2
                      Induced Change Citric acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (T86C) of SLC13A2 leads to the decrease of citric acid levels compared with control group.
               Regulating Pair (3) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (Y228C) of SLC13A2
                      Induced Change Citric acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (Y228C) of SLC13A2 leads to the decrease of citric acid levels compared with control group.
               Regulating Pair (4) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (Y432C) of SLC13A2
                      Induced Change Citric acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (Y432C) of SLC13A2 leads to the decrease of citric acid levels compared with control group.
            Glutaric acid Click to Show/Hide the Full List of Regulating Pair(s):   4 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (M539C) of SLC13A2
                      Induced Change Glutaric acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (M539C) of SLC13A2 leads to the decrease of glutaric acid levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (N525C) of SLC13A2
                      Induced Change Glutaric acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (N525C) of SLC13A2 leads to the decrease of glutaric acid levels compared with control group.
               Regulating Pair (3) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (T86C) of SLC13A2
                      Induced Change Glutaric acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (T86C) of SLC13A2 leads to the decrease of glutaric acid levels compared with control group.
               Regulating Pair (4) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (Y228C) of SLC13A2
                      Induced Change Glutaric acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (Y228C) of SLC13A2 leads to the decrease of glutaric acid levels compared with control group.
            Oxoglutaric acid Click to Show/Hide the Full List of Regulating Pair(s):   5 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (T86C) of SLC13A2
                      Induced Change Oxoglutaric acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (T86C) of SLC13A2 leads to the decrease of oxoglutaric acid levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (Y228C) of SLC13A2
                      Induced Change Oxoglutaric acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (Y228C) of SLC13A2 leads to the decrease of oxoglutaric acid levels compared with control group.
               Regulating Pair (3) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (Y432C) of SLC13A2
                      Induced Change Oxoglutaric acid concentration: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (Y432C) of SLC13A2 leads to the decrease of oxoglutaric acid levels compared with control group.
               Regulating Pair (4) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (M539C) of SLC13A2
                      Induced Change Oxoglutaric acid concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (M539C) of SLC13A2 leads to the increase of oxoglutaric acid levels compared with control group.
               Regulating Pair (5) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (N525C) of SLC13A2
                      Induced Change Oxoglutaric acid concentration: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (N525C) of SLC13A2 leads to the increase of oxoglutaric acid levels compared with control group.
            Succinic acid Click to Show/Hide the Full List of Regulating Pair(s):   5 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair (1) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (L83C) of SLC13A2
                      Induced Change Succinic acid concentration: decrease (FC = 0.96-0.99)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (L83C) of SLC13A2 leads to the decrease of succinic acid levels compared with control group.
               Regulating Pair (2) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (M539C) of SLC13A2
                      Induced Change Succinic acid concentration: decrease (FC = 0.96-0.99)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (M539C) of SLC13A2 leads to the decrease of succinic acid levels compared with control group.
               Regulating Pair (3) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (N525C) of SLC13A2
                      Induced Change Succinic acid concentration: decrease (FC = 0.96-0.99)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (N525C) of SLC13A2 leads to the decrease of succinic acid levels compared with control group.
               Regulating Pair (4) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (Y228C) of SLC13A2
                      Induced Change Succinic acid concentration: decrease (FC = 0.96-0.99)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (Y228C) of SLC13A2 leads to the decrease of succinic acid levels compared with control group.
               Regulating Pair (5) Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mutation (Y432C) of SLC13A2
                      Induced Change Succinic acid concentration: decrease (FC = 0.96-0.99)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that mutation (Y432C) of SLC13A2 leads to the decrease of succinic acid levels compared with control group.
References
1 Mapping Functionally Important Residues in the Na +/Dicarboxylate Cotransporter, NaDC1. Biochemistry. 2017 Aug 22;56(33):4432-4441.
2 Functional analysis of a species-specific inhibitor selective for human Na+-coupled citrate transporter (NaCT/SLC13A5/mINDY). Biochem J. 2020 Nov 13;477(21):4149-4165.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.