Details of Protein

General Information of Protein (ID: PRT00563)
Name Small ubiquitin-related modifier 3 (SUMO3)
Synonyms   Click to Show/Hide Synonyms of This Protein
SUMO-3; SMT3 homolog 1; SUMO-2; Ubiquitin-like protein SMT3A; Smt3A; SUMO3; SMT3A; SMT3H1
Gene Name SUMO3 Gene ID
6612
UniProt ID
P55854
Family Small ubiquitin-related modifier (SURM)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFR
FDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF
Structure
1U4A ; 2IO1 ; 2MP2 ; 6K5R ; 6NNQ
Function Ubiquitin-like protein which can be covalently attached to target lysines either as a monomer or as a lysine-linked polymer. Does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process. Plays a role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Covalent attachment to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2 or CBX4. Plays a role in the regulation of sumoylation status of SETX.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Glutamine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glutamine addition (12 hours)
                      Induced Change SUMO3 protein expression levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Inflammatory bowel disease [ICD-11: DD72]
                      Details It is reported that glutamine addition causes the increase of SUMO3 protein expression compared with control group.
References
1 Proteomic analysis of glutamine-treated human intestinal epithelial HCT-8 cells under basal and inflammatory conditions. Proteomics. 2006 Jul;6(13):3926-37.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.