Details of Protein
General Information of Protein (ID: PRT00563) | |||||
---|---|---|---|---|---|
Name | Small ubiquitin-related modifier 3 (SUMO3) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
SUMO-3; SMT3 homolog 1; SUMO-2; Ubiquitin-like protein SMT3A; Smt3A; SUMO3; SMT3A; SMT3H1
|
||||
Gene Name | SUMO3 | Gene ID | |||
UniProt ID | |||||
Family | Small ubiquitin-related modifier (SURM) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFR
FDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF |
||||
Structure | |||||
Function | Ubiquitin-like protein which can be covalently attached to target lysines either as a monomer or as a lysine-linked polymer. Does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process. Plays a role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Covalent attachment to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2 or CBX4. Plays a role in the regulation of sumoylation status of SETX. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Glutamine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Glutamine addition (12 hours) | |||||
Induced Change | SUMO3 protein expression levels: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Inflammatory bowel disease [ICD-11: DD72] | |||||
Details | It is reported that glutamine addition causes the increase of SUMO3 protein expression compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Proteomic analysis of glutamine-treated human intestinal epithelial HCT-8 cells under basal and inflammatory conditions. Proteomics. 2006 Jul;6(13):3926-37. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.