Details of Protein

General Information of Protein (ID: PRT00558)
Name Polymerase delta-interacting protein 3 (POLDIP3)
Synonyms   Click to Show/Hide Synonyms of This Protein
S6K1 Aly/REF-like target; SKAR; Poldip3
Gene Name Poldip3 Gene ID
73826
UniProt ID
Q8BG81
Family RNA recognition motif (Rnrmo)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MADLSLDELIRKRGTAAKGRLSVRPGIGGVRSRVGIQHSLVNQPARTATFQQRFDARQKI
GLSDARLKLGVKDAREKLLQKDARFRIKGKVQDAREMLNSRKQQGTVPQKPRQVADAREK
ISLKRRSPAAFTSPPIGTVTPALKLTKTIQVPQQKAMVPLHAHPAGMRINVVNNHQAKQN
LYDLDEDDDIVVPVPPKQMKFAATGSLVHHMTGLSSSKLSMSKALPLTKVVQNDAYTAPV
LPSSVRTKALTSMSRTLVNKEEPPKELPPAEPVLSPLEGTKMTVNNLHPRVTEEDIVELF
CVCGALKRARLVHPGVAEVVFVKKDDAITAYKKYNNRCLDGQPMKCNLHMNGNVITSDQP
ILLRLSDSPSVKKESELPRRGNPASSNPPAEVDPDTVLRALFKSSGASVTTQPTEFKIKL
Function Is involved in regulation of translation. Is preferentially associated with CBC-bound spliced mRNA-protein complexes during the pioneer round of mRNA translation. Contributes to enhanced translational efficiency of spliced over nonspliced mRNAs. Recruits activated ribosomal protein S6 kinase beta-1 I/RPS6KB1 to newly synthesized mRNA. Involved in nuclear mRNA export; probably mediated by association with the TREX complex.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic oxygen compounds
            Glucose Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glucose (low concentration) addition (17.50 hours)
                      Induced Change POLDIP3 protein abundance levels: increase (FC = 1.98)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Cerebral stroke [ICD-11: 8B11]
                      Details It is reported that low glucose addition causes the increase of POLDIP3 protein abundance compared with control group.
References
1 Quantitative Proteomics Reveals the Beneficial Effects of Low Glucose on Neuronal Cell Survival in an in vitro Ischemic Penumbral Model. Front Cell Neurosci. 2020 Sep 1;14:272.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.