Details of Protein
| General Information of Protein (ID: PRT00547) | |||||
|---|---|---|---|---|---|
| Name | Prosaposin (PSAP) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
Proactivator polypeptide; GLBA; SAP1
|
||||
| Gene Name | PSAP | Gene ID | |||
| UniProt ID | |||||
| Family | Amoebapore (AMB) | ||||
| TC Number | TC: 1.C.35.2.1 (Click to Show/Hide the Complete TC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MYALFLLASLLGAALAGPVLGLKECTRGSAVWCQNVKTASDCGAVKHCLQTVWNKPTVKS
LPCDICKDVVTAAGDMLKDNATEEEILVYLEKTCDWLPKPNMSASCKEIVDSYLPVILDI IKGEMSRPGEVCSALNLCESLQKHLAELNHQKQLESNKIPELDMTEVVAPFMANIPLLLY PQDGPRSKPQPKDNGDVCQDCIQMVTDIQTAVRTNSTFVQALVEHVKEECDRLGPGMADI CKNYISQYSEIAIQMMMHMQPKEICALVGFCDEVKEMPMQTLVPAKVASKNVIPALELVE PIKKHEVPAKSDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEV VDTYGSSILSILLEEVSPELVCSMLHLCSGTRLPALTVHVTQPKDGGFCEVCKKLVGYLD RNLEKNSTKQEILAALEKGCSFLPDPYQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIG ACPSAHKPLLGTEKCIWGPSYWCQNTETAAQCNAVEHCKRHVWN |
||||
| Structure | |||||
| Function | Saposin-A and saposin-C stimulate the hydrolysis of glucosylceramide by beta-glucosylceramidase (EC 3.2.1.45) and galactosylceramide by beta-galactosylceramidase (EC 3.2.1.46). Saposin-C apparently acts by combining with the enzyme and acidic lipid to form an activated complex, rather than by solubilizing the substrate.; Saposin-B stimulates the hydrolysis of galacto-cerebroside sulfate by arylsulfatase A (EC 3.1.6.8), GM1 gangliosides by beta-galactosidase (EC 3.2.1.23) and globotriaosylceramide by alpha-galactosidase A (EC 3.2.1.22). Saposin-B forms a solubilizing complex with the substrates of the sphingolipid hydrolases.; Saposin-D is a specific sphingomyelin phosphodiesterase activator (EC 3.1.4.12).; [Prosaposin]: Behaves as a myelinotrophic and neurotrophic factor, these effects are mediated by its G-protein-coupled receptors, GPR37 and GPR37L1, undergoing ligand-mediated internalization followed by ERK phosphorylation signaling.; Saposins are specific low-molecular mass non-enzymic proteins, they participate in the lysosomal degradation of sphingolipids, which takes place by the sequential action of specific hydrolases. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| Glutamine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Glutamine absence (16 hours) | |||||
| Induced Change | PSAP protein abundance levels: increase (FC = 1.80) | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Hepatocellular carcinoma [ICD-11: 2C12] | |||||
| Details | It is reported that glutamine absence causes the increase of PSAP protein abundance compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Quantitative proteomics analysis reveals glutamine deprivation activates fatty acid -oxidation pathway in HepG2 cells. Amino Acids. 2016 May;48(5):1297-307. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

