Details of Protein
General Information of Protein (ID: PRT00544) | |||||
---|---|---|---|---|---|
Name | Glutathione S-transferase P (GSTP1) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
Gst P1; GST YF-YF; GST class-pi; GST-piB; Preadipocyte growth factor; Gstp1; Gstpib
|
||||
Gene Name | Gstp1 | Gene ID | |||
UniProt ID | |||||
Family | Transferases (EC 2) | ||||
EC Number | EC: 2.5.1.18 (Click to Show/Hide the Complete EC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MPPYTIVYFPVRGRCEAMRMLLADQGQSWKEEVVTIDTWMQGLLKPTCLYGQLPKFEDGD
LTLYQSNAILRHLGRSLGLYGKNQREAAQMDMVNDGVEDLRGKYVTLIYTNYENGKNDYV KALPGHLKPFETLLSQNQGGKAFIVGDQISFADYNLLDLLLIHQVLAPGCLDNFPLLSAY VARLSARPKIKAFLSSPEHVNRPINGNGKQ |
||||
Structure | |||||
Function | Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Involved in the formation of glutathione conjugates of both prostaglandin A2 (PGA2) and prostaglandin J2 (PGJ2). Participates in the formation of novel hepoxilin regioisomers. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Methionine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Methionine decrease (504 hours) | |||||
Induced Change | GSTP1 protein expression levels: decrease (FC = 0.33) | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Fatty liver disease [ICD-11: DB92] | |||||
Details | It is reported that methionine decrease causes the decrease of GSTP1 protein expression compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Proteomic analysis of mice fed methionine and choline deficient diet reveals marker proteins associated with steatohepatitis. PLoS One. 2015 Apr 7;10(4):e0120577. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.