Details of Protein

General Information of Protein (ID: PRT00543)
Name Glutathione S-transferase P (GSTP1)
Synonyms   Click to Show/Hide Synonyms of This Protein
GST class-pi; GSTP1-1; GSTP1; FAEES3; GST3
Gene Name GSTP1 Gene ID
2950
UniProt ID
P09211
Family Transferases (EC 2)
EC Number   EC: 2.5.1.18  (Click to Show/Hide the Complete EC Tree)
Transferase
Alkyl/aryl transferase
Alkyl/aryl transferase
EC: 2.5.1.18
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGD
LTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYV
KALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAY
VGRLSARPKLKAFLASPEYVNLPINGNGKQ
Structure
10GS ; 11GS ; 12GS ; 13GS ; 14GS ; 16GS ; 17GS ; 18GS ; 19GS ; 1AQV ; 1AQW ; 1AQX ; 1EOG ; 1EOH ; 1GSS ; 1KBN ; 1LBK ; 1MD3 ; 1MD4 ; 1PGT ; 1PX6 ; 1PX7 ; 1ZGN ; 20GS ; 22GS ; 2A2R ; 2A2S ; 2GSS ; 2J9H ; 2PGT ; 3CSH ; 3CSI ; 3CSJ ; 3DD3 ; 3DGQ ; 3GSS ; 3GUS ; 3HJM ; 3HJO ; 3HKR ; 3IE3 ; 3KM6 ; 3KMN ; 3KMO ; 3N9J ; 3PGT ; 4GSS ; 4PGT ; 5DAK ; 5DAL ; 5DCG ; 5DDL ; 5DJL ; 5DJM ; 5GSS ; 5J41 ; 5JCW ; 5L6X ; 5X79 ; 6AP9 ; 6GSS ; 6LLX ; 6Y1E ; 7GSS ; 8GSS ; 9GSS
Function Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Involved in the formation of glutathione conjugates of both prostaglandin A2 (PGA2) and prostaglandin J2 (PGJ2). Participates in the formation of novel hepoxilin regioisomers. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Arginine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Arginine decrease (48 hours)
                      Induced Change GSTP1 protein abundance levels: decrease (FC = 1.6)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Colon cancer [ICD-11: 2B90]
                      Details It is reported that arginine decrease causes the decrease of GSTP1 protein abundance compared with control group.
References
1 Arginine deficiency in preconfluent intestinal Caco-2 cells modulates expression of proteins involved in proliferation, apoptosis, and heat shock response. Proteomics. 2007 Feb;7(4):565-577.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.