Details of Protein

General Information of Protein (ID: PRT00540)
Name Actin beta (ACTB)
Synonyms   Click to Show/Hide Synonyms of This Protein
Beta-actin; ACTB
Gene Name ACTB Gene ID
60
UniProt ID
P60709
Family Actin (ACT)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
Structure
3BYH ; 3D2U ; 3J82 ; 3LUE ; 6ANU ; 6ICT ; 6ICV ; 6LTJ ; 6MBJ ; 6MBK ; 6MBL ; 6NBW ; 6OX0 ; 6OX1 ; 6OX2 ; 6OX3 ; 6OX4 ; 6OX5 ; 6V62 ; 6V63 ; 6WK1 ; 6WK2
Function Actin is a highly conserved protein that polymerizes to produce filaments that form cross-linked networks in the cytoplasm of cells. Actin exists in both monomeric (G-actin) and polymeric (F-actin) forms, both forms playing key functions, such as cell motility and contraction. In addition to their role in the cytoplasmic cytoskeleton, G- and F-actin also localize in the nucleus, and regulate gene transcription and motility and repair of damaged DNA.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic oxygen compounds
            Glucose Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glucose addition (16 hours)
                      Induced Change ACTB protein expression levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hyperglycemic hyperosmolar syndrome [ICD-11: 5A20]
                      Details It is reported that glucose addition causes the increase of ACTB protein expression compared with control group.
            Mannitol Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Mannitol addition (16 hours)
                      Induced Change ACTB protein expression levels: decrease
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hyperglycemic hyperosmolar syndrome [ICD-11: 5A20]
                      Details It is reported that mannitol addition causes the decrease of ACTB protein expression compared with control group.
References
1 High-glucose-induced changes in macrophage secretome: regulation of immune response. Mol Cell Biochem. 2019 Feb;452(1-2):51-62.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.