Details of Protein

General Information of Protein (ID: PRT00522)
Name Rotamase A (PPIA)
Synonyms   Click to Show/Hide Synonyms of This Protein
PPIase A; Cyclophilin A; Cyclosporin A-binding protein; Rotamase A; PPIA; CYPA
Gene Name PPIA Gene ID
5478
UniProt ID
P62937
Family Isomerases (EC 5)
EC Number   EC: 5.2.1.8  (Click to Show/Hide the Complete EC Tree)
Isomerase
Cis-trans-isomerase
Cis-trans isomerase
EC: 5.2.1.8
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGF
MCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTE
WLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
Structure
1AK4 ; 1AWQ ; 1AWR ; 1AWS ; 1AWT ; 1AWU ; 1AWV ; 1BCK ; 1CWA ; 1CWB ; 1CWC ; 1CWF ; 1CWH ; 1CWI ; 1CWJ ; 1CWK ; 1CWL ; 1CWM ; 1CWO ; 1FGL ; 1M63 ; 1M9C ; 1M9D ; 1M9E ; 1M9F ; 1M9X ; 1M9Y ; 1MF8 ; 1MIK ; 1NMK ; 1OCA ; 1RMH ; 1VBS ; 1VBT ; 1W8L ; 1W8M ; 1W8V ; 1YND ; 1ZKF ; 2ALF ; 2CPL ; 2CYH ; 2MS4 ; 2MZU ; 2N0T ; 2RMA ; 2RMB ; 2X25 ; 2X2A ; 2X2C ; 2X2D ; 2XGY ; 3CYH ; 3CYS ; 3K0M ; 3K0N ; 3K0O ; 3K0P ; 3K0Q ; 3K0R ; 3ODI ; 3ODL ; 3RDD ; 4CYH ; 4IPZ ; 4N1M ; 4N1N ; 4N1O ; 4N1P ; 4N1Q ; 4N1R ; 4N1S ; 4YUG ; 4YUH ; 4YUI ; 4YUJ ; 4YUK ; 4YUL ; 4YUM ; 4YUN ; 4YUO ; 4YUP ; 5CYH ; 5F66 ; 5FJB ; 5KUL ; 5KUN ; 5KUO ; 5KUQ ; 5KUR ; 5KUS ; 5KUU ; 5KUV ; 5KUW ; 5KUZ ; 5KV0 ; 5KV1 ; 5KV2 ; 5KV3 ; 5KV4 ; 5KV5 ; 5KV6 ; 5KV7 ; 5LUD ; 5NOQ ; 5NOR ; 5NOS ; 5NOT ; 5NOU ; 5NOV ; 5NOW ; 5NOX ; 5NOY ; 5NOZ ; 5T9U ; 5T9W ; 5T9Z ; 5TA2 ; 5TA4 ; 5WC7 ; 6BTA ; 6GJI ; 6GJJ ; 6GJL ; 6GJM ; 6GJN ; 6GJP ; 6GJR ; 6GJY ; 6GS6 ; 6I42 ; 6U5C ; 6U5D ; 6U5E ; 6U5G ; 6X3R ; 6X3Y ; 6X4M ; 6X4N ; 6X4O ; 6X4P ; 6X4Q ; 6Y9V ; 6Y9W ; 6Y9X ; 6Y9Y ; 6Y9Z ; 6ZDJ
Function Catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Exerts a strong chemotactic effect on leukocytes partly through activation of one of its membrane receptors BSG/CD147, initiating a signaling cascade that culminates in MAPK/ERK activation. Activates endothelial cells (ECs) in a proinflammatory manner by stimulating activation of NF-kappa-B and ERK, JNK and p38 MAP-kinases and by inducing expression of adhesion molecules including SELE and VCAM1. Induces apoptosis in ECs by promoting the FOXO1-dependent expression of CCL2 and BCL2L11 which are involved in EC chemotaxis and apoptosis. In response to oxidative stress, initiates proapoptotic and antiapoptotic signaling in ECs via activation of NF-kappa-B and AKT1 and up-regulation of antiapoptotic protein BCL2. Negatively regulates MAP3K5/ASK1 kinase activity, autophosphorylation and oxidative stress-induced apoptosis mediated by MAP3K5/ASK1. Necessary for the assembly of TARDBP in heterogeneous nuclear ribonucleoprotein (hnRNP) complexes and regulates TARDBP binding to RNA UG repeats and TARDBP-dependent expression of HDAC6, ATG7 and VCP which are involved in clearance of protein aggregates. Plays an important role in platelet activation and aggregation. Regulates calcium mobilization and integrin ITGA2B:ITGB3 bidirectional signaling via increased ROS production as well as by facilitating the interaction between integrin and the cell cytoskeleton. Binds heparan sulfate glycosaminoglycans. Inhibits replication of influenza A virus (IAV). Inhibits ITCH/AIP4-mediated ubiquitination of matrix protein 1 (M1) of IAV by impairing the interaction of ITCH/AIP4 with M1, followed by the suppression of the nuclear export of M1, and finally reduction of the replication of IAV.; (Microbial infection) May act as a mediator between human SARS coronavirus nucleoprotein and BSG/CD147 in the process of invasion of host cells by the virus.; (Microbial infection) Stimulates RNA-binding ability of HCV NS5A in a peptidyl-prolyl cis-trans isomerase activity-dependent manner.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Glutamine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glutamine absence (16 hours)
                      Induced Change PPIA protein abundance levels: increase (FC = 1.48)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hepatocellular carcinoma [ICD-11: 2C12]
                      Details It is reported that glutamine absence causes the increase of PPIA protein abundance compared with control group.
            Oxoglutaric acid Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [2]
                      Introduced Variation Oxoglutaric acid addition (336 hours)
                      Induced Change PPIA protein expression levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Parkinsonism [ICD-11: 8A00]
                      Details It is reported that oxoglutaric acid addition causes the increase of PPIA protein expression compared with control group.
References
1 Quantitative proteomics analysis reveals glutamine deprivation activates fatty acid -oxidation pathway in HepG2 cells. Amino Acids. 2016 May;48(5):1297-307.
2 Dietary keto-acid feed-back on pituitary activity in gilthead sea bream: effects of oral doses of AKG. A proteomic approach. Gen Comp Endocrinol. 2010 Dec 1;169(3):284-92.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.