Details of Protein
| General Information of Protein (ID: PRT00520) | |||||
|---|---|---|---|---|---|
| Name | tRNA-splicing endonuclease Sen15 (TSEN15) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
tRNA-intron endonuclease Sen15; Tsen15; Sen15
|
||||
| Gene Name | Tsen15 | Gene ID | |||
| UniProt ID | |||||
| Family | Lyases (EC 4) | ||||
| EC Number | EC: 4.6.1.16 (Click to Show/Hide the Complete EC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MEERSDSEPTPGCSGPGPAPVRDGGGAHTWAPEDAWMGTHPKYLEMMELDIGDATQVYIA
FLVYLDLMESKSWHEVNCVGIPELQLICLLGTEIEGEGLQTVVPTPISASLSHNRIREIL KASRKLQGDPELPMSFTLAIVESDSTIVYYKLTDGFMLPDPQNISLRR |
||||
| Function | Non-catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5' and 3' splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3' cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body. The tRNA splicing endonuclease is also involved in mRNA processing via its association with pre-mRNA 3'-end processing factors, establishing a link between pre-tRNA splicing and pre-mRNA 3'-end formation, suggesting that the endonuclease subunits function in multiple RNA-processing events. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic oxygen compounds | ||||||
| Glucose | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
 click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Glucose (low concentration) addition (17.50 hours) | |||||
| Induced Change | TSEN15 protein abundance levels: increase (FC = 1.55) | |||||
| Summary | Introduced Variation
Induced Change
|
|||||
| Disease Status | Cerebral stroke [ICD-11: 8B11] | |||||
| Details | It is reported that low glucose addition causes the increase of TSEN15 protein abundance compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Quantitative Proteomics Reveals the Beneficial Effects of Low Glucose on Neuronal Cell Survival in an in vitro Ischemic Penumbral Model. Front Cell Neurosci. 2020 Sep 1;14:272. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.