Details of Protein

General Information of Protein (ID: PRT00518)
Name Pancreas duodenum homeobox 1 (PDX1)
Synonyms   Click to Show/Hide Synonyms of This Protein
Insulin promoter factor 1; IPF-1; Islet/duodenum homeobox 1; IDX-1; Somatostatin-transactivating factor 1; STF-1; Pdx1; Ipf1
Gene Name Pdx1 Gene ID
29535
UniProt ID
P52947
Family Antp homeobox (Antp)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MNSEEQYYAATQLYKDPCAFQRGPVPEFSANPPACLYMGRQPPPPPPPQFAGSLGTLEQG
SPPDISPYEVPPLADDPAGAHLHHHLPAQLGLAHPPPGPFPNGTETGGLEEPSRVHLPFP
WMKSTKAHAWKSQWAGGAYAAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELA
VMLNLTERHIKIWFQNRRMKWKKEEDKKRSSGTTSGGGGGEEPEQDCAVTSGEELLALPP
PPPPGGAVPSGVPAAAREGRLPSGLSASPQPSSIAPLRPQEPR
Function Activates insulin and somatostatin gene transcription. Key regulator of islet peptide hormone expression but also responsible for the development of the pancreas, most probably by determining maturation and differentiation of common pancreatic precursor cells in the developing gut. As part of a PDX1:PBX1b:MEIS2b complex in pancreatic acinar cells is involved in the transcriptional activation of the ELA1 enhancer; the complex binds to the enhancer B element and cooperates with the transcription factor 1 complex (PTF1) bound to the enhancer A element. Binds the DNA sequence 5'-CC[CT]TAATGGG-3'.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Leucine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Leucine addition (72 hours)
                      Induced Change PDX1 mRNAlevel levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Type 2 diabetes mellitus [ICD-11: 5A11]
                      Details It is reported that leucine addition causes the increase of PDX1 mRNA levels compared with control group.
References
1 Chronic exposure to leucine in vitro induces -cell dysfunction in INS-1E cells and mouse islets. J Endocrinol. 2012 Oct;215(1):79-88.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.