Details of Protein
| General Information of Protein (ID: PRT00509) | |||||
|---|---|---|---|---|---|
| Name | Prolyl 4-hydroxylase alpha-2 (P4HA2) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
4-PH alpha-2; Procollagen-proline,2-oxoglutarate-4-dioxygenase subunit alpha-2; P4ha2
|
||||
| Gene Name | P4ha2 | Gene ID | |||
| UniProt ID | |||||
| Family | Oxidoreductases (EC 1) | ||||
| EC Number | EC: 1.14.11.2 (Click to Show/Hide the Complete EC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MKLQVLVLVLLMSWFGVLSWVQAEFFTSIGHMTDLIYAEKDLVQSLKEYILVEEAKLAKI
KSWASKMEALTSRSAADPEGYLAHPVNAYKLVKRLNTDWPALGDLVLQDASAGFVANLSV QRQFFPTDEDESGAARALMRLQDTYKLDPDTISRGELPGTKYQAMLSVDDCFGLGRSAYN EGDYYHTVLWMEQVLKQLDAGEEATVTKSLVLDYLSYAVFQLGDLHRAVELTRRLLSLDP SHERAGGNLRYFERLLEEERGKSLSNQTDAGLATQENLYERPTDYLPERDVYESLCRGEG VKLTPRRQKKLFCRYHHGNRVPQLLIAPFKEEDEWDSPHIVRYYDVMSDEEIERIKEIAK PKLARATVRDPKTGVLTVASYRVSKSSWLEEDDDPVVARVNRRMQHITGLTVKTAELLQV ANYGMGGQYEPHFDFSRSDDEDAFKRLGTGNRVATFLNYMSDVEAGGATVFPDLGAAIWP KKGTAVFWYNLLRSGEGDYRTRHAACPVLVGCKWVSNKWFHERGQEFLRPCGTTEVD |
||||
| Function | Catalyzes the post-translational formation of 4-hydroxyproline in -Xaa-Pro-Gly- sequences in collagens and other proteins. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic oxygen compounds | ||||||
| Glucose | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Glucose (low concentration) addition (17.50 hours) | |||||
| Induced Change | P4HA2 protein abundance levels: increase (FC = 1.59) | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Cerebral stroke [ICD-11: 8B11] | |||||
| Details | It is reported that low glucose addition causes the increase of P4HA2 protein abundance compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Quantitative Proteomics Reveals the Beneficial Effects of Low Glucose on Neuronal Cell Survival in an in vitro Ischemic Penumbral Model. Front Cell Neurosci. 2020 Sep 1;14:272. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

