Details of Protein

General Information of Protein (ID: PRT00507)
Name Small nuclear ribonucleoprotein E (SNRPE)
Synonyms   Click to Show/Hide Synonyms of This Protein
snRNP-E; Sm protein E; Sm-E; SmE; SNRPE
Gene Name SNRPE Gene ID
6635
UniProt ID
P62304
Family Ribonucleoprotein (RPT)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDD
AEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN
Structure
3CW1 ; 3JCR ; 3PGW ; 4F7U ; 4PJO ; 4V98 ; 4WZJ ; 5MQF ; 5O9Z ; 5XJC ; 5XJL ; 5XJQ ; 5XJR ; 5XJS ; 5XJT ; 5XJU ; 5YZG ; 5Z56 ; 5Z57 ; 5Z58 ; 6AH0 ; 6FF7 ; 6ICZ ; 6ID0 ; 6ID1 ; 6QDV ; 6QW6 ; 6QX9 ; 6V4X ; 6Y53 ; 6Y5Q ; 7A5P ; 7ABG ; 7B0Y
Function Plays role in pre-mRNA splicing as core component of the SMN-Sm complex that mediates spliceosomal snRNP assembly and as component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. Is also a component of the minor U12 spliceosome. As part of the U7 snRNP it is involved in histone 3'-end processing. May indirectly play a role in hair development.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Glutamine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glutamine absence (16 hours)
                      Induced Change SNRPE protein abundance levels: decrease (FC = 0.55)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hepatocellular carcinoma [ICD-11: 2C12]
                      Details It is reported that glutamine absence causes the decrease of SNRPE protein abundance compared with control group.
References
1 Quantitative proteomics analysis reveals glutamine deprivation activates fatty acid -oxidation pathway in HepG2 cells. Amino Acids. 2016 May;48(5):1297-307.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.