Details of Protein
General Information of Protein (ID: PRT00501) | |||||
---|---|---|---|---|---|
Name | Hypoxia-inducible factor 2-alpha (EPAS1) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
EPAS-1; Basic-helix-loop-helix-PAS protein MOP2; Class E basic helix-loop-helix protein 73; bHLHe73; HIF-1-alpha-like factor; HLF; Hypoxia-inducible factor 2-alpha; HIF-2-alpha; HIF2-alpha; Member of PAS protein 2; PAS domain-containing protein 2; EPAS1; BHLHE73; HIF2A; MOP2; PASD2
|
||||
Gene Name | EPAS1 | Gene ID | |||
UniProt ID | |||||
Family | Transcription factor (TF) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MTADKEKKRSSSERRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLA
ISFLRTHKLLSSVCSENESEAEADQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMG LTQVELTGHSIFDFTHPCDHEEIRENLSLKNGSGFGKKSKDMSTERDFFMRMKCTVTNRG RTVNLKSATWKVLHCTGQVKVYNNCPPHNSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLD SKTFLSRHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKG QVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTE SLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGDAIISLDFGNQN FEESSAYGKAILPPSQPWATELRSHSTQSEAGSLPAFTVPQAAAPGSTTPSATSSSSSCS TPNSPEDYYTSLDNDLKIEVIEKLFAMDTEAKDQCSTQTDFNELDLETLAPYIPMDGEDF QLSPICPEERLLAENPQSTPQHCFSAMTNIFQPLAPVAPHSPFLLDKFQQQLESKKTEPE HRPMSSIFFDAGSKASLPPCCGQASTPLSSMGGRSNTQWPPDPPLHFGPTKWAVGDQRTE FLGAAPLGPPVSPPHVSTFKTRSAKGFGARGPDVLSPAMVALSNKLKLKRQLEYEEQAFQ DLSGGDPPGGSTSHLMWKRMKNLRGGSCPLMPDKPLSANVPNDKFTQNPMRGLGHPLRHL PLPQPPSAISPGENSKSRFPPQCYATQYQDYSLSSAHKVSGMASRLLGPSFESYLLPELT RYDCEVNVPVLGSSTLLQGGDLLRALDQAT |
||||
Structure | |||||
Function | Transcription factor involved in the induction of oxygen regulated genes. Heterodimerizes with ARNT; heterodimer binds to core DNA sequence 5'-TACGTG-3' within the hypoxia response element (HRE) of target gene promoters. Regulates the vascular endothelial growth factor (VEGF) expression and seems to be implicated in the development of blood vessels and the tubular system of lung. May also play a role in the formation of the endothelium that gives rise to the blood brain barrier. Potent activator of the Tie-2 tyrosine kinase expression. Activation requires recruitment of transcriptional coactivators such as CREBBP and probably EP300. Interaction with redox regulatory protein APEX1 seems to activate CTAD. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Lactic acid | Click to Show/Hide the Full List of Regulating Pair(s): 2 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair (1) |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Lactic acid addition (6 hours) | |||||
Induced Change | EPAS1 protein expression levels: increase (FC = 1.8) | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Cervical Cancer [ICD-11: 2C77] | |||||
Details | It is reported that lactic acid addition causes the increase of EPAS1 protein expression compared with control group. | |||||
Regulating Pair (2) |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Lactic acid addition (6 hours) | |||||
Induced Change | EPAS1 mRNA levels: increase (FC = 1.8) | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Cervical Cancer [ICD-11: 2C77] | |||||
Details | It is reported that lactic acid addition causes the increase of EPAS1 mRNA levels compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Lactate promotes glutamine uptake and metabolism in oxidative cancer cells. Cell Cycle. 2016;15(1):72-83. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.