Details of Protein

General Information of Protein (ID: PRT00497)
Name Retinol-binding protein 1 (RBP1)
Synonyms   Click to Show/Hide Synonyms of This Protein
Cellular retinol-binding protein; CRBP; Cellular retinol-binding protein I; CRBP-I; RBP1; CRBP1
Gene Name RBP1 Gene ID
5947
UniProt ID
P09455
Family Fatty acid binding protein (FABP)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRN
YIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEM
RVEGVVCKQVFKKVQ
Structure
5H8T ; 5H9A ; 5HA1 ; 5HBS ; 5LJB ; 5LJC ; 5LJD ; 5LJE ; 5LJG ; 5LJH ; 5LJK ; 6E5L ; 6E5T ; 6E6M
Function Cytoplasmic retinol-binding protein. Accepts retinol from the transport protein STRA6, and thereby contributes to retinol uptake, storage and retinoid homeostasis.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Glutamine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Glutamine absence (16 hours)
                      Induced Change RBP1 protein abundance levels: increase (FC = 2.74)
                      Summary Introduced Variation         Induced Change 
                      Disease Status Hepatocellular carcinoma [ICD-11: 2C12]
                      Details It is reported that glutamine absence causes the increase of RBP1 protein abundance compared with control group.
References
1 Quantitative proteomics analysis reveals glutamine deprivation activates fatty acid -oxidation pathway in HepG2 cells. Amino Acids. 2016 May;48(5):1297-307.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.