Details of Protein

General Information of Protein (ID: PRT00496)
Name Proto-oncogene c-Crk (c-Crk)
Synonyms   Click to Show/Hide Synonyms of This Protein
Proto-oncogene c-Crk; p38; CRK
Gene Name CRK Gene ID
1398
UniProt ID
P46108
Family Growth factor receptor binding protein (GFRBP)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHY
IINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSR
SRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRG
MIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYA
RVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPD
EDFS
Structure
1JU5 ; 2DVJ ; 2EYV ; 2EYW ; 2EYX ; 2EYY ; 2EYZ ; 2MS4 ; 5UL6 ; 6ATV
Function Involved in cell branching and adhesion mediated by BCAR1-CRK-RAPGEF1 signaling and activation of RAP1.; [Isoform Crk-II]: Regulates cell adhesion, spreading and migration. Mediates attachment-induced MAPK8 activation, membrane ruffling and cell motility in a Rac-dependent manner. Involved in phagocytosis of apoptotic cells and cell motility via its interaction with DOCK1 and DOCK4. May regulate the EFNA5-EPHA3 signaling.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Methionine Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Methionine decrease (120 hours)
                      Induced Change CRK protein expression levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Stomach cancer [ICD-11: 2B72]
                      Details It is reported that methionine decrease causes the increase of CRK protein expression compared with control group.
References
1 Applying proteomic methodologies to analyze the effect of methionine restriction on proliferation of human gastric cancer SGC7901 cells. Clin Chim Acta. 2007 Feb;377(1-2):206-12.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.