Details of Protein
General Information of Protein (ID: PRT00495) | |||||
---|---|---|---|---|---|
Name | Calcium-dependent protease small 2 (CAPNS2) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
CSS2; Calpain small subunit 2; CAPNS2
|
||||
Gene Name | CAPNS2 | Gene ID | |||
UniProt ID | |||||
Family | EF-hand domain-containing (EHC) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MFLAKALLEGADRGLGEALGGLFGGGGQRREGGGRNIGGIVGGIVNFISEAAAAQYTPEP
PPTQQHFTSVEASESEEVRRFRQQFTQLAGPDMEVGATDLMNILNKVLSKHKDLKTDGFS LDTCRSIVSVMDSDTTGKLGFEEFKYLWNNIKKWQCVYKQYDRDHSGSLGSSQLRGALQA AGFQLNEQLYQMIVRRYANEDGDMDFNNFISCLVRLDAMFRAFKSLDRDRDGLIQVSIKE WLQLTMYS |
||||
Function | Calcium-regulated non-lysosomal thiol-protease which catalyzes limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction. This small subunit may act as a tissue-specific chaperone of the large subunit, possibly by helping it fold into its correct conformation for activity. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Glutamine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Glutamine addition (12 hours) | |||||
Induced Change | CAPNS2 protein expression levels: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Inflammatory bowel disease [ICD-11: DD72] | |||||
Details | It is reported that glutamine addition causes the increase of CAPNS2 protein expression compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Proteomic analysis of glutamine-treated human intestinal epithelial HCT-8 cells under basal and inflammatory conditions. Proteomics. 2006 Jul;6(13):3926-37. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.