Details of Protein
| General Information of Protein (ID: PRT00488) | |||||
|---|---|---|---|---|---|
| Name | Tubulin-specific chaperone A (TBCA) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
TCP1-chaperonin cofactor A; Tubulin-folding cofactor A; CFA; TBCA
|
||||
| Gene Name | TBCA | Gene ID | |||
| UniProt ID | |||||
| Family | Tubulin-related (Tub) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQES
RMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKLEA |
||||
| Structure | |||||
| Function | Tubulin-folding protein; involved in the early step of the tubulin folding pathway. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| Glutamine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
 click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Glutamine addition (12 hours) | |||||
| Induced Change | TBCA protein expression levels: increase | |||||
| Summary | Introduced Variation
Induced Change
|
|||||
| Disease Status | Inflammatory bowel disease [ICD-11: DD72] | |||||
| Details | It is reported that glutamine addition causes the increase of TBCA protein expression compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Proteomic analysis of glutamine-treated human intestinal epithelial HCT-8 cells under basal and inflammatory conditions. Proteomics. 2006 Jul;6(13):3926-37. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.