Details of Protein

General Information of Protein (ID: PRT00481)
Name Tropomyosin alpha-1 chain (TPM1)
Synonyms   Click to Show/Hide Synonyms of This Protein
Alpha-tropomyosin; Tropomyosin-1; Tpm1; Alpha-tm; Tpma
Gene Name Tpm1 Gene ID
24851
UniProt ID
P04692
Family Tropomyosin (Tmyo)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKY
SEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAE
ERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAE
FAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI
Structure
1IHQ ; 1MV4 ; 1TMZ ; 2B9C ; 2G9J ; 3AZD
Function Binds to actin filaments in muscle and non-muscle cells. Plays a central role, in association with the troponin complex, in the calcium dependent regulation of vertebrate striated muscle contraction. Smooth muscle contraction is regulated by interaction with caldesmon. In non-muscle cells is implicated in stabilizing cytoskeleton actin filaments.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Organic acids and derivatives
            Citrulline Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Citrulline addition (1336 hours)
                      Induced Change TPM1 protein expression levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that citrulline addition causes the increase of TPM1 protein expression compared with control group.
References
1 Citrulline Supplementation Induces Changes in Body Composition and Limits Age-Related Metabolic Changes in Healthy Male Rats. J Nutr. 2015 Jul;145(7):1429-37.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.