Details of Protein
| General Information of Protein (ID: PRT00477) | |||||
|---|---|---|---|---|---|
| Name | Nuclear migration protein JNM1 (JNM1) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
YMR294W; JNM1; INS1
|
||||
| Gene Name | JNM1 | Gene ID | |||
| UniProt ID | |||||
| Family | Nuclear migration protein (NMP) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MNVIDLSDPAINVDYDSLIGIDNEESQEIFENEVKEDGQQEEQEEASSRKDGLIVEPGRD
VESLRRAIRDQLLFKIHRQNQSDCADARKLSNDEEDESRQQKLERIREELEELKIENLTS EMQTEIKELCEIQSKLATESSSRLTNLRKKLLETYEGQDTVILPNIILDTSNIKRLQKLD QKISLMERFVGIPEALEAEEDRKSVHSKVNELYRSIQLLQGDDKAEGKLQKFRDRLVELN EEFENSLLGKKIQQDLRLKDDTVSKLVMPENKVKEINSMYSMFKQYQDSLPLLAERMKSL NKMNNRVIEVYETTKGLDSQITSIQEQGKVWLKALNELDKKFDEQEVKIRENMEQIRRKI DTLEDEALQRNSK |
||||
| Function | Component of the dynactin complex which assists cytoplasmic dynein by increasing its processivity and by regulation of its cargo binding. The dynactin complex is required for the spindle translocation late in anaphase and is involved in a cell wall synthesis checkpoint. JNM1 is associated with the rod and links it to the projecting sidearm. Required for proper nuclear migration during the mitotic cell cycle and for astral microtubule development. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic oxygen compounds | ||||||
| Glucose | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Glucose addition (1.50 hours) | |||||
| Induced Change | JNM1 protein expression levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Healthy individual | |||||
| Details | It is reported that glucose addition causes the increase of JNM1 protein expression compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Proteome analysis of yeast response to various nutrient limitations. Mol Syst Biol. 2006;2:2006.0026. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

