Details of Protein
General Information of Protein (ID: PRT00467) | |||||
---|---|---|---|---|---|
Name | Stromal cell-derived factor 4 (SDF4) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
Cab45; 45 kDa calcium-binding protein; SDF-4; Sdf4; Cab45
|
||||
Gene Name | Sdf4 | Gene ID | |||
UniProt ID | |||||
Family | Calcium-binding protein (CBP) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MVWLVAMTPRQSSLCGLAAHGLWFLGLVLLMDATARPANHSSTRERAANREENEIMPPDH
LNGVKLEMDGHLNKDFHQEVFLGKDMDGFDEDSEPRRSRRKLMVIFSKVDVNTDRRISAK EMQHWIMEKTAEHFQEAVKENKLHFRAVDPDGDGHVSWDEYKVKFLASKGHNEREIAEAI KNHEELKVDEETQEVLGNLRDRWYQADNPPADLLLTEDEFLSFLHPEHSRGMLKFMVKEI FRDLDQDGDKQLSLPEFISLPVGTVENQQGQDIDDNWVKDRKKEFEELIDSNHDGIVTME ELENYMDPMNEYNALNEAKQMIAIADENQNHHLEPEEILKYSEFFTGSKLMDYARNVHEE F |
||||
Function | May regulate calcium-dependent activities in the endoplasmic reticulum lumen or post-ER compartment. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic oxygen compounds | ||||||
Glucose | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Glucose (low concentration) addition (17.50 hours) | |||||
Induced Change | SDF4 protein abundance levels: increase (FC = 3.05) | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Cerebral stroke [ICD-11: 8B11] | |||||
Details | It is reported that low glucose addition causes the increase of SDF4 protein abundance compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Quantitative Proteomics Reveals the Beneficial Effects of Low Glucose on Neuronal Cell Survival in an in vitro Ischemic Penumbral Model. Front Cell Neurosci. 2020 Sep 1;14:272. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.