Details of Protein
| General Information of Protein (ID: PRT00454) | |||||
|---|---|---|---|---|---|
| Name | Nuclear ribonucleoprotein H2 (HNRPH2) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
hnRNP H2; FTP-3; Heterogeneous nuclear ribonucleoprotein H'; hnRNP H'; HNRNPH2; FTP3; HNRPH2
|
||||
| Gene Name | HNRNPH2 | Gene ID | |||
| UniProt ID | |||||
| Family | RNA recognition motif (Rnrmo) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MMLSTEGREGFVVKVRGLPWSCSADEVMRFFSDCKIQNGTSGIRFIYTREGRPSGEAFVE
LESEEEVKLALKKDRETMGHRYVEVFKSNSVEMDWVLKHTGPNSPDTANDGFVRLRGLPF GCSKEEIVQFFSGLEIVPNGMTLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRY IEIFKSSRAEVRTHYDPPRKLMAMQRPGPYDRPGAGRGYNSIGRGAGFERMRRGAYGGGY GGYDDYGGYNDGYGFGSDRFGRDLNYCFSGMSDHRYGDGGSSFQSTTGHCVHMRGLPYRA TENDIYNFFSPLNPMRVHIEIGPDGRVTGEADVEFATHEDAVAAMAKDKANMQHRYVELF LNSTAGTSGGAYDHSYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGY GGGYGGQSSMSGYDQVLQENSSDYQSNLA |
||||
| Structure | |||||
| Function | This protein is a component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complexes which provide the substrate for the processing events that pre-mRNAs undergo before becoming functional, translatable mRNAs in the cytoplasm. Binds poly(RG). | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| Arginine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Arginine decrease (48 hours) | |||||
| Induced Change | HNRNPH2 protein abundance levels: decrease (FC = 2.0) | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Colon cancer [ICD-11: 2B90] | |||||
| Details | It is reported that arginine decrease causes the decrease of HNRNPH2 protein abundance compared with control group. | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

