Details of Protein
| General Information of Protein (ID: PRT00451) | |||||
|---|---|---|---|---|---|
| Name | E3-binding protein (E3BP) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
Dihydrolipoamide dehydrogenase-binding protein of pyruvate dehydrogenase complex; Pyruvate dehydrogenase protein X component, mitochondrial; Lipoyl-containing pyruvate dehydrogenase complex component X; proX; PDHX; PDX1
|
||||
| Gene Name | PDHX | Gene ID | |||
| UniProt ID | |||||
| Family | Transferases (EC 2) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MAASWRLGCDPRLLRYLVGFPGRRSVGLVKGALGWSVSRGANWRWFHSTQWLRGDPIKIL
MPSLSPTMEEGNIVKWLKKEGEAVSAGDALCEIETDKAVVTLDASDDGILAKIVVEEGSK NIRLGSLIGLIVEEGEDWKHVEIPKDVGPPPPVSKPSEPRPSPEPQISIPVKKEHIPGTL RFRLSPAARNILEKHSLDASQGTATGPRGIFTKEDALKLVQLKQTGKITESRPTPAPTAT PTAPSPLQATAGPSYPRPVIPPVSTPGQPNAVGTFTEIPASNIRRVIAKRLTESKSTVPH AYATADCDLGAVLKVRQDLVKDDIKVSVNDFIIKAAAVTLKQMPDVNVSWDGEGPKQLPF IDISVAVATDKGLLTPIIKDAAAKGIQEIADSVKALSKKARDGKLLPEEYQGGSFSISNL GMFGIDEFTAVINPPQACILAVGRFRPVLKLTEDEEGNAKLQQRQLITVTMSSDSRVVDD ELATRFLKSFKANLENPIRLA |
||||
| Structure | |||||
| Function | Required for anchoring dihydrolipoamide dehydrogenase (E3) to the dihydrolipoamide transacetylase (E2) core of the pyruvate dehydrogenase complexes of eukaryotes. This specific binding is essential for a functional PDH complex. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| Arginine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Arginine decrease (48 hours) | |||||
| Induced Change | PDHX protein abundance levels: increase (FC = 2.1) | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Colon cancer [ICD-11: 2B90] | |||||
| Details | It is reported that arginine decrease causes the increase of PDHX protein abundance compared with control group. | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

