Details of Protein
General Information of Protein (ID: PRT00445) | |||||
---|---|---|---|---|---|
Name | Acyl-CoA thioesterase 2 (ACOT2) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
Acyl-CoA thioesterase 2; Acyl coenzyme A thioester hydrolase; MTE-I; Very-long-chain acyl-CoA thioesterase; Acot2; Mte1
|
||||
Gene Name | Acot2 | Gene ID | |||
UniProt ID | |||||
Family | Hydrolases (EC 3) | ||||
EC Number | EC: 3.1.2.2 (Click to Show/Hide the Complete EC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MVASSFAVLRASRLCQQDWKSWARLFVPPPLSTGGRTTWARTNATLSVEPEGRSCWDEPL
SIAVRGLAPEQPVTLRSALRDEKGALFRAHARYRADAGGELNLARAPALGGSFSGLEPMG LLWAMEPERPLWRLIKRDVQTPFLVELEVLDGHEPDGGQRLAQAVHERHFLAPGVRRVPV REGRVRATLFLPPEPGPFPGIIDLFGVGGGLLEYRASLLAGKGFAVMALAYYNYDDLPKS IETMHMEYFEEAVNYLRSHPEVKGPGIGLLGISKGGELGLAMASFLKGITAAVVINGSVA AVGNTISYKDETIPPVSLLRNQVKMTKDGLLDVVEALQSPLVDKKSFIPVERSDTTFLFL VGQDDHNWKSEFYADEISKRLQAHGKEKPQIICYPAAGHYIEPPYFPLCSAGMHLLVGAN ITFGGEPRAHAVAQVDAWQQLQTFFHKQLGSKS |
||||
Function | Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. Acyl-coenzyme A thioesterase 2/ACOT2 displays higher activity toward long chain acyl CoAs (C14-C20). The enzyme is involved in enhancing the hepatic fatty acid oxidation in mitochondria. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Methionine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Methionine decrease (504 hours) | |||||
Induced Change | ACOT2 protein expression levels: increase (FC = 3.20) | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Fatty liver disease [ICD-11: DB92] | |||||
Details | It is reported that methionine decrease causes the increase of ACOT2 protein expression compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Proteomic analysis of mice fed methionine and choline deficient diet reveals marker proteins associated with steatohepatitis. PLoS One. 2015 Apr 7;10(4):e0120577. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.