Details of Protein
| General Information of Protein (ID: PRT00432) | |||||
|---|---|---|---|---|---|
| Name | Short-chain specific acyl-CoA dehydrogenase (ACADS) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
SCAD; Butyryl-CoA dehydrogenase; Acads
|
||||
| Gene Name | Acads | Gene ID | |||
| UniProt ID | |||||
| Family | Oxidoreductases (EC 1) | ||||
| EC Number | EC: 1.3.8.1 (Click to Show/Hide the Complete EC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MAAALLARARGPLRRALGVRDWRRLHTVYQSVELPETHQMLRQTCRDFAEKELVPIAAQL
DREHLFPTAQVKKMGELGLLAMDVPEELSGAGLDYLAYSIALEEISRACASTGVIMSVNN SLYLGPILKFGSAQQKQQWITPFTNGDKIGCFALSEPGNGSDAGAASTTAREEGDSWVLN GTKAWITNSWEASATVVFASTDRSRQNKGISAFLVPMPTPGLTLGKKEDKLGIRASSTAN LIFEDCRIPKENLLGEPGMGFKIAMQTLDMGRIGIASQALGIAQASLDCAVKYAENRNAF GAPLTKLQNIQFKLADMALALESARLLTWRAAMLKDNKKPFTKESAMAKLAASEAATAIS HQAIQILGGMGYVTEMPAERYYRDARITEIYEGTSEIQRLVIAGHLLRSYRS |
||||
| Function | Short-chain specific acyl-CoA dehydrogenase is one of the acyl-CoA dehydrogenases that catalyze the first step of mitochondrial fatty acid beta-oxidation, an aerobic process breaking down fatty acids into acetyl-CoA and allowing the production of energy from fats. The first step of fatty acid beta-oxidation consists in the removal of one hydrogen from C-2 and C-3 of the straight-chain fatty acyl-CoA thioester, resulting in the formation of trans-2-enoyl-CoA. Among the different mitochondrial acyl-CoA dehydrogenases, short-chain specific acyl-CoA dehydrogenase acts specifically on acyl-CoAs with saturated 4 to 6 carbons long primary chains. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic oxygen compounds | ||||||
| Glucose | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Glucose decrease (4 hours) | |||||
| Induced Change | ACADS protein expression levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Myocardial infarction [ICD-11: BA41] | |||||
| Details | It is reported that glucose decrease causes the increase of ACADS protein expression compared with control group. | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

