Details of Protein
General Information of Protein (ID: PRT00421) | |||||
---|---|---|---|---|---|
Name | Superoxide dismutase Mn (SOD Mn) | ||||
Synonyms |
Click to Show/Hide Synonyms of This Protein
SOD2
|
||||
Gene Name | SOD2 | Gene ID | |||
UniProt ID | |||||
Family | Oxidoreductases (EC 1) | ||||
EC Number | EC: 1.15.1.1 (Click to Show/Hide the Complete EC Tree) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
Sequence |
MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVN
NLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEA IKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLL GIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK |
||||
Structure | |||||
Function | Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems. | ||||
Regulatory Network | |||||
Full List of Metabolite(s) Regulating This Protein | ||||||
---|---|---|---|---|---|---|
Organic acids and derivatives | ||||||
Glutamine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
Detailed Information |
Metabo Info
![]() |
|||||
Regulating Pair |
Experim Info
![]() |
[1] | ||||
Introduced Variation | Glutamine addition (5 hours) | |||||
Induced Change | SOD2 protein expression levels: increase | |||||
Summary | Introduced Variation
![]() ![]() ![]() |
|||||
Disease Status | Inflammatory bowel disease [ICD-11: DD72] | |||||
Details | It is reported that glutamine addition causes the increase of SOD2 protein expression compared with control group. | |||||
References | |||||
---|---|---|---|---|---|
1 | Human duodenal proteome modulations by glutamine and antioxidants. Proteomics Clin Appl. 2010 Mar;4(3):325-36. |
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.