Details of Protein
| General Information of Protein (ID: PRT00421) | |||||
|---|---|---|---|---|---|
| Name | Superoxide dismutase Mn (SOD Mn) | ||||
| Synonyms |
Click to Show/Hide Synonyms of This Protein
SOD2
|
||||
| Gene Name | SOD2 | Gene ID | |||
| UniProt ID | |||||
| Family | Oxidoreductases (EC 1) | ||||
| EC Number | EC: 1.15.1.1 (Click to Show/Hide the Complete EC Tree) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein | |||||
| Sequence |
MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVN
NLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEA IKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLL GIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK |
||||
| Structure | |||||
| Function | Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems. | ||||
| Regulatory Network | |||||
| Full List of Metabolite(s) Regulating This Protein | ||||||
|---|---|---|---|---|---|---|
| Organic acids and derivatives | ||||||
| Glutamine | Click to Show/Hide the Full List of Regulating Pair(s): 1 Pair(s) | |||||
| Detailed Information |
Metabo Info
click to show the details of this metabolite
|
|||||
| Regulating Pair |
Experim Info
click to show the details of experiment for validating this pair
|
[1] | ||||
| Introduced Variation | Glutamine addition (5 hours) | |||||
| Induced Change | SOD2 protein expression levels: increase | |||||
| Summary | Introduced Variation
|
|||||
| Disease Status | Inflammatory bowel disease [ICD-11: DD72] | |||||
| Details | It is reported that glutamine addition causes the increase of SOD2 protein expression compared with control group. | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Human duodenal proteome modulations by glutamine and antioxidants. Proteomics Clin Appl. 2010 Mar;4(3):325-36. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

