Details of Protein

General Information of Protein (ID: PRT00417)
Name Histone H4 (HHF1)
Synonyms   Click to Show/Hide Synonyms of This Protein
YBR009C; YNL030W; YBR0122; N2752; HHF1; HHF2
Gene Name HHF1 Gene ID
852294
UniProt ID
P02309
Family Histone (HST)
  Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Function) of This Protein
Sequence
MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLK
SFLESVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG
Structure
1E6I ; 1ID3 ; 1Q1A ; 1SZC ; 1SZD ; 2DVQ ; 2DVR ; 2E3K ; 2FSB ; 2H2H ; 2L5A ; 2QQF ; 2QQG ; 3TO6 ; 4JJN ; 4KUD ; 4PSX ; 4TWI ; 4TWJ ; 5W0V ; 5ZBA ; 5ZBB ; 6GEJ ; 6GEN ; 6QLD ; 6RXJ ; 6RXK ; 6RXL ; 6RXM ; 6RXO ; 6RXP ; 6RXQ ; 6RXR
Function Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Component of the UAF (upstream activation factor) complex which interacts with the upstream element of the RNA polymerase I promoter and forms a stable preinitiation complex. Together with SPT15/TBP UAF seems to stimulate basal transcription to a fully activated level.
Regulatory Network
Full List of Metabolite(s) Regulating This Protein
      Homogeneous non-metal compounds
            Nitrogen Click to Show/Hide the Full List of Regulating Pair(s):   1 Pair(s)
               Detailed Information Metabo  Info click to show the details of this metabolite
               Regulating Pair Experim Info click to show the details of experiment for validating this pair [1]
                      Introduced Variation Nitrogen limitation (1.50 hours)
                      Induced Change HHF1 MORE protein expression levels: increase
                      Summary Introduced Variation         Induced Change 
                      Disease Status Healthy individual
                      Details It is reported that nitrogen limitation causes the increase of HHF1 MORE protein expression compared with control group.
References
1 Proteome analysis of yeast response to various nutrient limitations. Mol Syst Biol. 2006;2:2006.0026.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.